CD8 alpha Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 alpha, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived CD8 alpha protein, expressed by HEK293, with N-Avi labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD8 alpha is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 alpha, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived CD8 alpha protein, expressed by HEK293, with N-Avi labeled tag.
Background
The CD8 alpha protein, an integral membrane glycoprotein, plays a pivotal role in the immune response, serving multiple functions in responses against both external and internal threats. In T-cells, it functions primarily as a coreceptor for the MHC class I molecule:peptide complex, interacting simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen-presenting cells (APCs). This interaction facilitates the recruitment of the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK, in turn, initiates various intracellular signaling pathways by phosphorylating diverse substrates, ultimately leading to lymphokine production, motility, adhesion, and the activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism, allowing the conjugation and lysis of multiple target cells. CD8A homodimer molecules also contribute to the survival and differentiation of activated lymphocytes into memory CD8 T-cells. CD8 alpha forms disulfide-linked heterodimers with CD8B at the cell surface and also homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. Additionally, it interacts with the MHC class I HLA-A/B2M dimer and associates with LCK in a zinc-dependent manner.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
XP_005575419 (N63-D223)
-
Gene ID102124337
-
Molecular Construction
-
N-term
-
(M42-D223)
Accession # XP_005575419 -
Avi-His
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
CD8A; Leu2 T-Lymphocyte Antigen; Prev. CD8; T-Cell Antigen Leu2; T-Cell Surface Glycoprotein CD8 Alpha Chain; T Cell Co-Receptor; T-Lymphocyte Differentiation Antigen T8/Leu-2; T8 T-Cell Antigen; CD8alpha; CD8a Antigen; P32; IMD116; CD8 Antigen, Alpha Polypeptide (P32); Leu2; CD8a Molecule; MAL; CD8 Subunit Alpha; OKT8 T-Cell Antigen
-
AA Sequence
NQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSRFVPVFLPAKPTTTPAPRPPTPAPTTASQPLSLRPEACRPAAGGSVNTRGLDFACD
-
Predicted Molecular Mass
21.3 kDa
-
Molecular Weight
Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
/
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)