CD8 alpha Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Measured by its binding ability in a functional ELISA. Immobilized Biotinylated Cynomolgus CD8 alpha Protein, His,Avi tag at 1 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate can bind Anti-CD8 alpha Antibody, Human IgG1 with a linear range of 0.06-1 ng/mL.

Cynomolgus

HEK293

C-Avi;C-His

XP_005575419 (N63-D223)

102124337

Biotin

NQFRVSPLGRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGTAARPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLRDFRQENEGYYFCSALSNSIMYFSRFVPVFLPAKPTTTPAPRPPTPAPTTASQPLSLRPEACRPAAGGSVNTRGLDFACD

Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.

/

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/sw-962-cell.html