CD83 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Human (HEK293, Fc) is the recombinant human-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Human (HEK293, Fc) is the recombinant human-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD83 Protein is suggested to play a significant role, potentially contributing to antigen presentation or mediating cellular interactions that ensue following lymphocyte activation. The specific mechanisms through which CD83 influences these processes, particularly in the context of immune responses, remain to be fully elucidated. As a monomer, CD83 may participate in distinct molecular events that impact antigen presentation and cellular interactions, highlighting its potential as a key regulatory element in modulating immune responses. In-depth investigations are needed to unravel the intricacies of CD83's function and its implications in the orchestration of immune processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q01151 (T20-A143)
-
Molecular Construction
-
N-term
-
CD83 (T20-A143)
Accession # Q01151 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD83; Cell Surface Protein HB15; CD83 Molecule; CD83 Antigen; HB15; HCD83; BL11; Cell-Surface Glycoprotein; CD83 Antigen (Activated B Lymphocytes, Immunoglobulin Superfamily); B-Cell Activation Protein
-
AA Sequence
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA
-
Predicted Molecular Mass
41.2 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)