CDH19 Protein, Human (Flag-MBP)
Based on 1 Customer Validation
CDH19 Protein, a calcium-dependent cell adhesion protein, engages in homophilic interactions, primarily connecting cells. This adhesive property suggests a potential role for cadherins, including CDH19, in facilitating the sorting of diverse cell types. CDH19 Protein, Human (Flag-MBP) is the recombinant human-derived CDH19 protein, expressed by E. coli , with N-MBP, N-Flag labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CDH19 Protein, a calcium-dependent cell adhesion protein, engages in homophilic interactions, primarily connecting cells. This adhesive property suggests a potential role for cadherins, including CDH19, in facilitating the sorting of diverse cell types. CDH19 Protein, Human (Flag-MBP) is the recombinant human-derived CDH19 protein, expressed by E. coli , with N-MBP, N-Flag labeled tag.
Background
CDH19 protein, belonging to the cadherin family, functions as a calcium-dependent cell adhesion protein. Exhibiting a preference for homophilic interactions, cadherins like CDH19 tend to engage with similar molecules on connecting cells. This homophilic binding capability suggests a role for cadherins, including CDH19, in facilitating the sorting of heterogeneous cell types, emphasizing their involvement in cellular adhesion processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-MBP;N-Flag
-
Accession
Q9H159-1 (G44-H569)
-
Gene ID/
-
Molecular Construction
-
N-term
-
MBP-Flag
-
CDH19 (G44-H569)
Accession # Q9H159-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CDH19; Cadherin 19, Type 2; Cadherin 19; Cadherin-19; CDH7; CDH7L2
-
AA Sequence
GWVWNQFFVPEEMNTTSHHIGQLRSDLDNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIQKLDREERSLYILRAQVIDIATGRAVEPESEFVIKVSDINDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTTGVIRISSKMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHTEASTTFIKIQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNGTITTSNSLDREISAWYNLSITATEKYNIEQISSIPLYVQVLNINDHAPEFSQYYETYVCENAGSGQVIQTISAVDRDESIEEHHFYFNLSVEDTNNSSFTIIDNQDNTAVILTNRTGFNLQEEPVFYISILIADNGIPSLTSTNTLTIH
-
Predicted Molecular Mass
100.9 kDa
-
Molecular Weight
Approximately 101 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
