CDK13 Protein, Human (sf9, GST)
CDK13 Protein, Human (sf9, GST) is the recombinant human-derived CDK13, expressed by sf9 insect cells , with GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CDK13 Protein, Human (sf9, GST) is the recombinant human-derived CDK13, expressed by sf9 insect cells , with GST labeled tag.
Background
CDK13-CCNT1 is a cyclin-dependent kinase with CTD kinase activity, essential for RNA splicing. It hyperphosphorylates the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit RPB1, acting as a key regulator of transcription elongation. It likely participates in RNA splicing by phosphorylating SRSF1/SF2 and plays a role during hematopoiesis. During HIV-1 infection, CDK13-CCNT1 interacts with HIV-1 Tat protein acetylated at 'Lys-50' and 'Lys-51', enhancing HIV-1 mRNA splicing and promoting the production of the doubly spliced HIV-1 protein Nef.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
Q14004-1 (Q673-S1054)
-
Gene ID8621
-
Protein Length
Partial
-
Synonyms
CDK13; Cell Division Protein Kinase 13; Prev. CDC2L5; Cyclin-Dependent Kinase 13; CDC2L; HCDK13; CHED; Cell Division Cycle 2-Like 5 (Cholinesterase-Related Cell Division Controller); Cholinesterase-Related Cell Division Controller; Mitogen-Activated Prote
-
AA Sequence
QLHSKRRPKICGPRYGETKEKDIDWGKRCVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRRQKQMGMTDDVSTIKAPRKDLSLGLDDS
-
Predicted Molecular Mass
71 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
