Copy Link Print Information

CDK19-CCNC Protein, Human (Active, sf9, His-GST)

CDK19 plays a key role in cellular homeostasis and developmental programming. CDK19 can interact with p53 to inhibit p53-mediated transcription of p21, and regulates the proliferation of hematopoietic stem cells and acute myeloid leukemia cells. Besides, CDK19 is the paralog of CDK8. CDK8 and CDK19 can cooperate with each other in stimulating NFκB-induced transcription and Dengue virus replication. CDK19-CCNC Protein, Human (Active, sf9, His-GST) is the recombinant human-derived CDK19-CCNC, expressed by Sf9 insect cells, with N-6*His and N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • CDK19-CCNC Protein, Human (Active, sf9, His-GST) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CDK19 plays a key role in cellular homeostasis and developmental programming. CDK19 can interact with p53 to inhibit p53-mediated transcription of p21, and regulates the proliferation of hematopoietic stem cells and acute myeloid leukemia cells. Besides, CDK19 is the paralog of CDK8. CDK8 and CDK19 can cooperate with each other in stimulating NFκB-induced transcription and Dengue virus replication[1][2][3]. CDK19-CCNC Protein, Human (Active, sf9, His-GST) is the recombinant human-derived CDK19-CCNC, expressed by Sf9 insect cells, with N-6*His and N-GST labeled tag.

Background

CDK19 is the paralog of CDK8. CDK19 plays a key role in cellular homeostasis and developmental programming[1]. CDK19 can interact with p53 to inhibit p53-mediated transcription of p21, and regulates the proliferation of hematopoietic stem cells and acute myeloid leukemia cells[2]. Besides, CDK8 and CDK19 can cooperate with each other in supporting leukemia cell growth, stimulating NFκB-induced transcription and Dengue virus replication[3].

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-6*His;N-GST
  • Accession

    Q9BWU1-1 (M1-Y502)&P24863-1 (M1-S283)

  • Gene ID
    23097
  • Molecular Construction
    • N-term
    • 6*His-GST
    • CDK19 (M1-Y502)
      Accession # Q9BWU1-1
    • C-term
    • N-term
    • 6*His-GST
    • CCNC (M1-S283)
      Accession # P24863-1
    • C-term
  • Synonyms

    CDK19; Cell Division Protein Kinase 19; Prev. CDC2L6; Cyclin-Dependent Kinase 19; Prev. CDK11; Cyclin-Dependent Kinase 11; BA346C16.3; Death-Preventing Kinase; KIAA1028; CDK8-Like Cyclin-Dependent Kinase; Cell Division Cycle 2-Like Protein Kinase 6; Cycli

  • AA Sequence

    MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHPSHQAHRY&MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

  • Predicted Molecular Mass

    85.9 kDa (CDK19) & 62.3 kDa (CCNC)

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CDK19-CCNC Protein, Human (Active, sf9, His-GST) Product Image
    1/16
  • CDK19-CCNC Protein, Human (Active, sf9, His-GST) Product Image