CELA2A Protein, Mouse (His)
CELA2A Protein, a serine protease, is involved in the digestion of dietary proteins in the small intestine. It cleaves peptide bonds, breaking down proteins into smaller peptides and amino acids for absorption. CELA2A Protein, Mouse (His) is the recombinant mouse-derived CELA2A protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CELA2A Protein, a serine protease, is involved in the digestion of dietary proteins in the small intestine. It cleaves peptide bonds, breaking down proteins into smaller peptides and amino acids for absorption. CELA2A Protein, Mouse (His) is the recombinant mouse-derived CELA2A protein, expressed by E. coli , with N-6*His labeled tag.
Background
The protein is involved in the regulation of innate immunity and the inflammatory response in response to IFN-gamma. It organizes the autophagic machinery by serving as a platform for the assembly of various proteins involved in autophagy. It also recognizes specific autophagy targets and coordinates target recognition with the initiation of autophagy.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P05208 (V31-N271)
-
Molecular Construction
-
N-term
-
6*His
-
CELA2A (V31-N271)
Accession # P05208 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CELA2A; Chymotrypsin Like Elastase Family Member 2A; Chymotrypsin Like Elastase 2A; Pancreatic Elastase IIA; ELA2A; Pancreatic Elastase 2; Chymotrypsin-Like Elastase Family Member 2A; Elastase-2A; Elastase 2A; AOMS4; Chymotrypsin-Like Elastase Family, Mem
-
AA Sequence
VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
-
Predicted Molecular Mass
29.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)