CG beta 3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CG beta 3 Protein, Human(HEK 293, His) is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG).
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CG beta 3 Protein, Human(HEK 293, His) is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG).
Background
Chorionic gonadotropin (CG) is a placental hormone that stimulates steroidogenesis and maintains the corpus luteum of pregnancy. CG comprises noncovalently bound α and, β subunits that are encoded by separate genes. Southern blot analyses indicate that there are six CGβ, genes and a single copy of the luteinizing hormone (LHP) gene clustered within a 60-kilobase (kb) region of chromosome 19. Transcriptional activation of the chorionic gonadotropin (CG) genes is linked to trophoblast differentiation. In a multistep process, cytotrophoblasts expressing only the alpha subunit differentiate into intermediates that coexpress the CG beta subunit[1][2].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P0DN86 (S21-Q165)
-
Molecular Construction
-
N-term
-
CG beta 3 (S21-Q165)
Accession # P0DN86 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CGB3; CG-Beta; Prev. CGB; Chorionic Gonadotropin Beta Subunit 4; Chorionic Gonadotropin Beta Subunit 3; Chorionic Gonadotrophin Chain Beta; Chorionic Gonadotropin, Beta Polypeptide; Chorionic Gonadotropin Beta Chain; Choriogonadotropin Subunit Beta 3; Cho
-
AA Sequence
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
-
Predicted Molecular Mass
16.7 kDa
-
Molecular Weight
Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. J L Jameson, et al. Isolation and characterization of the human chorionic gonadotropin beta subunit (CG beta) gene cluster: regulation of transcriptionally active CG beta gene by cyclic AMP. Mol Cell Biol. 1988 Dec;8(12):5100-7. [Content Brief]
[2]. B L Strauss, et al. Expression of the beta subunit of chorionic gonadotropin in transgenic mice. J Biol Chem. 1994 Feb 18;269(7):4968-73. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
