CHRNA1 Protein, Mouse (His-SUMO)
The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes significant conformational changes upon binding of acetylcholine. This change affects all subunits, causing the opening of ion-conducting channels across the plasma membrane. CHRNA1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived CHRNA1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
The CHRNA1 protein, also known as the alpha-1 subunit of the acetylcholine receptor (AChR), plays a crucial role in mediating cellular responses upon acetylcholine binding. As a component of the AChR, it is part of a pentameric structure consisting of two alpha chains, a beta, a delta, and either a gamma (in immature muscle) or epsilon (in mature muscle) chain. Upon acetylcholine binding, the AChR undergoes an extensive conformational change across all subunits, resulting in the opening of an ion-conducting channel across the plasma membrane. This process is integral to the transmission of nerve signals at the neuromuscular junction. Additionally, the muscle heteropentamer, comprising alpha-1, beta-1, delta, and epsilon subunits, interacts with the alpha-conotoxin ImII, further highlighting the intricate molecular interactions involved in the functionality of CHRNA1 within the acetylcholine receptor complex.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P04756 (S21-L230)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
CHRNA1 (S21-L230)
Accession # P04756 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CHRNA1; Nicotinic Acetylcholine Receptor Alpha Subunit; Prev. CHRNA; Nicotinic Cholinergic Receptor Alpha 1; Acetylcholine Receptor Subunit Alpha; ACHRD; Cholinergic Receptor, Nicotinic, Alpha Polypeptide 1 (Muscle); CMS1A; Acetylcholine Receptor, Nicotin
-
AA Sequence
SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
-
Predicted Molecular Mass
40.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
