CHRNA7 Protein, Human (His)
Based on 1 Customer Validation
CHRNA7 Protein, Human (His) is the recombinant human-derived CHRNA7 protein, expressed by E. coli, with N-6*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CHRNA7 Protein, Human (His) is the recombinant human-derived CHRNA7 protein, expressed by E. coli, with N-6*His tag.
Background
CHRNA7 is a component of neuronal acetylcholine receptors (nAChRs), which function as pentameric, ligand-gated cation channels with high calcium permeability among other activities. nAChRs are excitatory neurotransmitter receptors formed by a collection of nAChR subunits known to mediate synaptic transmission in the nervous system and the neuromuscular junction. Each nAChR subunit confers differential attributes to channel properties, including activation, deactivation and desensitization kinetics, pH sensitivity, cation permeability, and binding to allosteric modulators. CHRNA7 forms homopentameric neuronal acetylcholine receptors abundantly expressed in the central nervous system, characterized by fast desensitization and high calcium permeability. It also forms heteropentamers with CHRNB2, mainly expressed in basal forebrain cholinergic neurons. It is involved in the modulation of calcium-dependent signaling pathways and influences the release of neurotransmitters, including dopamine, glutamate, and GABA. CHRNA7 is also expressed in non-neuronal cells such as immune cells like lymphocytes, monocytes, and macrophages. In T cells, activation induces metabotropic signaling that results in an increase of intracellular Ca2+ concentrations, independent of ionotropic receptor functions. In macrophages, it is required for acetylcholine-mediated inhibition of TNF and other inflammatory cytokine release. Once activated by acetylcholine, nicotine, or other agonists, it selectively inhibits the production of pro-inflammatory cytokines while leaving anti-inflammatory cytokines undisturbed. It stimulates the cholinergic anti-inflammatory pathway, controlling inflammation by inhibiting NFKB nuclear translocation and activating the JAK2-STAT3 pathway, independently of ion channel activity. Additionally, it is expressed in the urothelium, where it modulates reflex bladder activity by increasing intracellular calcium through internal stores and decreasing basal ATP release (by similar).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P36544-1 (G23-T230)
-
Gene ID1139/89832
-
Molecular Construction
-
N-term
-
6*His
-
CHRNA7 (G23-T230)
Accession # P36544-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CHRNA7; A7nAChR; Cholinergic Receptor Nicotinic Alpha 7 Subunit; NACHRA7; Nicotinic Acetylcholine Receptor Subunit Alpha-7; NAChR7; Neuronal Acetylcholine Receptor Subunit Alpha-7; Neuronal Acetylcholine Receptor Protein, Alpha-7 Chain; Cholinergic Recept
-
AA Sequence
GEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT
-
Predicted Molecular Mass
30.4 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)