CHST15 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc(4,6-SO(4)) units. It also sulfates the unique non-reducing terminal sequence GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc(4,6-SO(4)) units. It also sulfates the unique non-reducing terminal sequence GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.
Background
CHST15 protein functions as a sulfotransferase with a distinctive role in transferring sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue in chondroitin sulfate A, leading to the formation of chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. Additionally, CHST15 transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), resulting in a highly sulfated structure reminiscent of thrombomodulin chondroitin sulfate. Beyond its role in chondroitin sulfate biosynthesis, CHST15 may function as a B-cell receptor involved in BCR ligation-mediated early activation, mediating regulatory signals crucial to B-cell development and the potential regulation of B-cell-specific RAG expression. However, the precise implications of these results in vivo remain unclear. The multifaceted activities of CHST15 highlight its importance in the intricate molecular processes governing chondroitin sulfate modifications and B-cell regulatory pathways, though further research is needed to elucidate its in vivo functions comprehensively.
Verified Bioactivity
Measured by its ability to transfer sulfate from PAPS to chondroitin sulfate. The specific activity is 529.117 pmol/min/μg that incubate at 37 ºC for 20 minutes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-10*His
-
Accession
Q7LFX5-1 (S99-T561)
-
Molecular Construction
-
N-term
-
His
-
CHST15 (S99-T561)
Accession # Q7LFX5-1 -
C-term
-
-
Protein Length
Lumenal domain
-
Synonyms
CHST15; B-Cell RAG-Associated Gene Protein; Carbohydrate Sulfotransferase 15; HBRAG; BRAG; B Cell RAG Associated Protein (GALNAC4S-6ST); GALNAC4S-6ST; B Cell RAG Associated Protein; KIAA0598; Alternative Protein CHST15; Carbohydrate (N-Acetylgalactosamine
-
AA Sequence
SGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT
-
Molecular Weight
Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)