CHST15 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc(4,6-SO(4)) units. It also sulfates the unique non-reducing terminal sequence GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CHST15 protein is a sulfotransferase that catalyzes the transfer of sulfate to GalNAc 4-sulfate in chondroitin sulfate A to form chondroitin sulfate E with GlcA-GalNAc(4,6-SO(4)) units. It also sulfates the unique non-reducing terminal sequence GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), similar to thrombomodulin chondroitin sulfate. CHST15 Protein, Human (HEK293, His) is the recombinant human-derived CHST15 protein, expressed by HEK293 , with N-His labeled tag.

Background

CHST15 protein functions as a sulfotransferase with a distinctive role in transferring sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue in chondroitin sulfate A, leading to the formation of chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. Additionally, CHST15 transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), resulting in a highly sulfated structure reminiscent of thrombomodulin chondroitin sulfate. Beyond its role in chondroitin sulfate biosynthesis, CHST15 may function as a B-cell receptor involved in BCR ligation-mediated early activation, mediating regulatory signals crucial to B-cell development and the potential regulation of B-cell-specific RAG expression. However, the precise implications of these results in vivo remain unclear. The multifaceted activities of CHST15 highlight its importance in the intricate molecular processes governing chondroitin sulfate modifications and B-cell regulatory pathways, though further research is needed to elucidate its in vivo functions comprehensively.

Verified Bioactivity

Measured by its ability to transfer sulfate from PAPS to chondroitin sulfate. The specific activity is 529.117 pmol/min/μg that incubate at 37 ºC for 20 minutes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CHST15 (S99-T561)
      Accession # Q7LFX5-1
    • C-term
  • Protein Length

    Lumenal domain

  • Synonyms

    CHST15; B-Cell RAG-Associated Gene Protein; Carbohydrate Sulfotransferase 15; HBRAG; BRAG; B Cell RAG Associated Protein (GALNAC4S-6ST); GALNAC4S-6ST; B Cell RAG Associated Protein; KIAA0598; Alternative Protein CHST15; Carbohydrate (N-Acetylgalactosamine

  • AA Sequence

    SGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT

  • Molecular Weight

    Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00