CLC2H Protein, Mouse (HEK293, Fc)
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q8C1T8 (R74-V218)
-
Gene ID94071
-
Molecular Construction
-
N-term
-
CLC2H (R74-V218)
Accession # Q8C1T8 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Clrf; Clec2h; C-type lectin-related protein F (Clr-f); C-type lectin domain family 2 member H
-
AA Sequence
RNKIPAMEDREPCYTACPSGWIGFGSKCFYFSEDMGNWTFSQSSCVASNSHLALFHSLEELNFLKRYKGTSDHWIGLHRASTQHPWIWTDNTEYSNLVLTRGGGECGFLSDNGISSGRSYTHRKWICSKFVSSCKSRVGSVPRHV
-
Predicted Molecular Mass
42.9 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
