CLEC12A/MICL Protein, Rat (HEK293, His)
CLEC12A/MICL (C-type lectin domain family 12 member A/myelosuppressive C-type lectin-like receptor) is a cell surface receptor that acts as a modulator of signaling cascades, specifically promoting target MAP kinases Protease. CLEC12A/MICL Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC12A/MICL protein, expressed by HEK293 , with N-His labeled tag. The total length of CLEC12A/MICL Protein, Rat (HEK293, His) is 205 a.a., with molecular weight of 32-45 kDa.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CLEC12A/MICL (C-type lectin domain family 12 member A/myelosuppressive C-type lectin-like receptor) is a cell surface receptor that acts as a modulator of signaling cascades, specifically promoting target MAP kinases Protease. CLEC12A/MICL Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC12A/MICL protein, expressed by HEK293 , with N-His labeled tag. The total length of CLEC12A/MICL Protein, Rat (HEK293, His) is 205 a.a., with molecular weight of 32-45 kDa.
Background
CLEC12A/MICL (C-type lectin domain family 12 member A/Myeloid inhibitory C-type lectin-like receptor) is a cell surface receptor that functions as a regulator of signaling cascades, specifically facilitating the tyrosine phosphorylation of target MAP kinases. Through its interactions with PTPN6 and PTPN11, CLEC12A/MICL is implicated in intricate cellular signaling processes, suggesting its significance in modulating immune responses and potentially serving as a target for therapeutic interventions aimed at manipulating immune system function.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag N-His
-
Accession
B4F798 (Y65-L269)
-
Molecular Construction
-
N-term
-
His
-
CLEC12A (Y65-L269)
Accession # B4F798 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CLEC12A; CLL1; C-Type Lectin Domain Family 12 Member A; C-Type Lectin Domain Family 12, Member A; DCAL-2; C-Type Lectin-Like Molecule-1; CLL-1; C-Type Lectin-Like Molecule 1; MICL; C-Type Lectin Protein CLL-1; Myeloid Inhibitory C-Type Lectin-Like Recepto
-
AA Sequence
YTTLETEMIKSNQLQRVKEELQENVSLQLMHNLNNSKKIKTLSAMLQNIATQLCQELSKKEPGHKCKPCPKASDWYKDSCYSRFQKYATWQESVEFCSARNASLLKVKNKDELEFIKSKELYNYWLALPPSKMYRSYELLSEKMFLSEGFKRSTYDITKMSCGFIRGEYVYYTNCDEEKYTMCEETASKVQVESVLSDLPEGSIL
-
Predicted Molecular Mass
26 kDa
-
Molecular Weight
Approximately 32-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
