1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. Macrophage-inducible C-type Lectin/CLEC4E
  6. CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution)

CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution)

Cat. No.: HY-P77336
Handling Instructions Technical Support

CLEC4E Protein is a calcium-dependent lectin displaying mannose-binding specificity, and induces the formation of Birbeck granules (BGs). CLEC4E Protein is a potent regulator of membrane superimposition and zippering, and binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution) is the recombinant Rhesus Macaque-derived CLEC4E protein, expressed by HEK293 , with N-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CLEC4E Protein is a calcium-dependent lectin displaying mannose-binding specificity, and induces the formation of Birbeck granules (BGs). CLEC4E Protein is a potent regulator of membrane superimposition and zippering, and binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution) is the recombinant Rhesus Macaque-derived CLEC4E protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CLEC4E Protein facilitates uptake of antigens and is involved in the routing or processing of antigen for presentation to T cells. C-type lectin domain family 4 member E is a major receptor on primary langerhans cells for Candida species, Saccharomyces species, and Malassezia furfur. C-type lectin domain family 4 member E protects against human immunodeficiency virus-1 (HIV-1) infection[1][2][3][4].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Trehalose 6, 6'-Dimycolate at 1 μg/mL(100 μL/well) can bind Rhesus Macaque CLEC4E. The ED50 for this effect is 0.2905 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Trehalose 6, 6'-Dimycolate at 1 μg/mL(100 μL/well) can bind Rhesus Macaque CLEC4E. The ED50 for this effect is 0.2905 μg/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

N-hFc

Accession

XP_001118423.1 (R41-I219)

Gene ID
Molecular Construction
N-term
hFc
CLEC4E (R41-I219)
Accession # XP_001118423.1
C-term
Protein Length

Partial

Synonyms
C-Type Lectin Domain Family 4 Member E; CLECSF9; MINCLE
AA Sequence

RCVVTYHIFQSCDEKKFQLHENFTELSCYNDGSGSVKNCCPSNWEYFQSSCYFFSTDTIPWTSSLKNCSAMGAHLVIINSQEEQEFLAYKKPKMKEFFIGLSDKVVEGQWHWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDATCFFSYFRICERLGINILNKGKSI

분자량

Approximately 49.1 kDa.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류

CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution)
Cat. No.:
HY-P77336
수량:
MCE Japan Authorized Agent: