CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution)
Based on 1 Customer Validation
CLEC4E Protein is a calcium-dependent lectin displaying mannose-binding specificity, and induces the formation of Birbeck granules (BGs). CLEC4E Protein is a potent regulator of membrane superimposition and zippering, and binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution) is the recombinant Rhesus Macaque-derived CLEC4E protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CLEC4E Protein is a calcium-dependent lectin displaying mannose-binding specificity, and induces the formation of Birbeck granules (BGs). CLEC4E Protein is a potent regulator of membrane superimposition and zippering, and binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. CLEC4E Protein, Rhesus Macaque (HEK293, hFc, solution) is the recombinant Rhesus Macaque-derived CLEC4E protein, expressed by HEK293 , with N-hFc labeled tag.
Background
CLEC4E Protein facilitates uptake of antigens and is involved in the routing or processing of antigen for presentation to T cells. C-type lectin domain family 4 member E is a major receptor on primary langerhans cells for Candida species, Saccharomyces species, and Malassezia furfur. C-type lectin domain family 4 member E protects against human immunodeficiency virus-1 (HIV-1) infection[1][2][3][4].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Trehalose 6, 6'-Dimycolate at 1 μg/mL(100 μL/well) can bind Rhesus Macaque CLEC4E. The ED50 for this effect is 0.2905 μg/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag N-hFc
-
Accession
XP_001118423.1 (R41-I219)
-
Molecular Construction
-
N-term
-
hFc
-
CLEC4E (R41-I219)
Accession # XP_001118423.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CLEC4E; Macrophage-Inducible C-Type Lectin; Prev. CLECSF9; C-Type Lectin Superfamily Member 9; MINCLE; C-Type Lectin Domain Family 4, Member E; C-Type Lectin Domain Family 4 Member E; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Sup
-
AA Sequence
RCVVTYHIFQSCDEKKFQLHENFTELSCYNDGSGSVKNCCPSNWEYFQSSCYFFSTDTIPWTSSLKNCSAMGAHLVIINSQEEQEFLAYKKPKMKEFFIGLSDKVVEGQWHWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDATCFFSYFRICERLGINILNKGKSI
-
Predicted Molecular Mass
49.1 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
