CLN5 Protein, Human (His)
- Species: Human
- Source: E. coli
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
O75503 (I47-L358)
-
Gene ID1203
-
Molecular Construction
-
N-term
-
CLN5 (I47-L358)
Accession # O75503 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Bis(monoacylglycero)phosphate synthase CLN5; BMP synthase CLN5; Ceroid-lipofuscinosis neuronal protein 5 (Protein CLN5); Palmitoyl protein thioesterase CLN5; S-depalmitoylase CLN5; Bis(monoacylglycero)phosphate synthase CLN5, secreted form; CLN5; BMPS
-
AA Sequence
IPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL
-
Predicted Molecular Mass
43.5 kDa
-
Pureté
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
