Copy Link Print Information

Clumping factor A Protein, S. aureus

Customer Review

Based on 1 Customer Validation

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Staphylococcus aureus
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Clumping factor A Protein, S. aureus Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

Background

Clumping factor A (ClfA) protein is a cell surface-associated protein that plays a significant role in bacterial virulence. This protein is implicated in the pathogenicity of bacteria by promoting bacterial attachment exclusively to the gamma-chain of human fibrinogen. By selectively binding to the gamma-chain, ClfA facilitates the adherence of bacteria to host tissues, a crucial step in the establishment of infections. Additionally, ClfA induces the formation of bacterial clumps, which may enhance bacterial survival and evasion of the host immune response. Serval researches indicatethat ClfA is a cell surface-associated protein implicated in virulence, specifically highlighting its role in promoting bacterial attachment to the gamma-chain of human fibrinogen and inducing the formation of bacterial clumps.

Technical Parameters

  • Species Staphylococcus aureus
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q6GB45 (G228-E558)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • Clumping factor A (G228-E558)
      Accession # Q6GB45
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SAS0752; clfA; Fibrinogen-binding protein A; Fibrinogen receptor A; Clumping factor A

  • AA Sequence

    GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

  • Predicted Molecular Mass

    36.1 kDa

  • Molecular Weight

    Approximately 43 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Clumping factor A Protein, S. aureus Product Image
    1/16
  • Clumping factor A Protein, S. aureus Product Image