CNPY3/PRAT4A Protein, Mouse (HEK293, Fc)

The CNPY3/PRAT4A protein is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for the correct folding and exit of TLRs (excluding TLR3) from the endoplasmic reticulum. CNPY3/PRAT4A is critical for innate and adaptive immune responses, interacts with HSP90B1, and is destroyed in the presence of ATP. CNPY3/PRAT4A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CNPY3/PRAT4A protein is a Toll-like receptor (TLR)-specific co-chaperone of HSP90B1 and is essential for the correct folding and exit of TLRs (excluding TLR3) from the endoplasmic reticulum. CNPY3/PRAT4A is critical for innate and adaptive immune responses, interacts with HSP90B1, and is destroyed in the presence of ATP. CNPY3/PRAT4A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CNPY3/PRAT4A protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CNPY3/PRAT4A Protein functions as a Toll-like receptor (TLR)-specific co-chaperone for HSP90B1, playing a vital role in the proper folding of TLRs, with the exception of TLR3, and thereby controlling their exit from the endoplasmic reticulum. This protein's involvement is critical for both innate and adaptive immune responses. CNPY3/PRAT4A interacts with HSP90B1, and this interaction is disrupted in the presence of ATP. Furthermore, it engages with various TLRs, including TLR1, TLR2, TLR4, and TLR9, with the strongest interaction observed with TLR4. The intricate interplay between CNPY3/PRAT4A and TLRs underscores its significance in regulating immune responses and highlights its role as a co-chaperone in the cellular mechanisms that govern the proper folding and trafficking of TLRs.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CNPY3 (A27-P272)
      Accession # Q9DAU1-1
    • hFc
    • C-term
  • Protein Length

    Full Length of Protein canopy homolog 4 Chain

  • Synonyms

    CNPY3; PRAT4A; Prev. TNRC5; Protein Associated With Toll-Like Receptor 4A; CAG4A; Trinucleotide Repeat Containing 5; Trinucleotide Repeat-Containing Gene 5 Protein; Canopy 3 Homolog (Zebrafish); Expanded Repeat-Domain Protein CAG/CTG 5; CAG Repeat Contain

  • AA Sequence

    APKLGPSPAGAEETDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDGKGSGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAERWSGKKGDIASLGGKKSKKKRSGVKGSSSGSSKQRKELGGLGEDANAEEEEGVQKASPLPHSP

  • Predicted Molecular Mass

    53.9 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00