CNT3 Protein, Human (sf9, Strep, His)
CNT3 Protein, Human (sf9, Strep, His) is the recombinant human-derived CNT3, expressed by sf9 insect cells , with Strep, His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CNT3 Protein, Human (sf9, Strep, His) is the recombinant human-derived CNT3, expressed by sf9 insect cells , with Strep, His labeled tag.
Background
CNT3 is a sodium-dependent, pyrimidine- and purine-selective transporter involved in the homeostasis of endogenous nucleosides. It exhibits the transport characteristics of the nucleoside transport system cib or N3 subtype (N3/cib), with marked transport of both thymidine and inosine, and employs a 2:1 sodium/nucleoside ratio. Additionally, CNT3 transports uridine, gemcitabine, 3'-azido-3'-deoxythymidine (AZT), ribavirin, and 3-deazauridine. by similar: It is also involved in the transport of nucleoside analogs such as gemcitabine and AZT.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Strep;His
-
Accession
Q9HAS3-1 (M70-F691)
-
Gene ID64078
-
Protein Length
Partial
-
Synonyms
SLC28A3; Concentrative Na(+)-Nucleoside Cotransporter 3; Solute Carrier Family 28 Member 3; Concentrative Na+-Nucleoside Cotransporter; CNT3; HCNT3; Solute Carrier Family 28 (Sodium-Coupled Nucleoside Transporter), Member 3; CNT 3; Solute Carrier Family 2
-
AA Sequence
MEDDDEEMQQKGCLERRYDTVCGFCRKHKTTLRHIIWGILLAGYLVMVISACVLNFHRALPLFVITVAAIFFVVWDHLMAKYEHRIDEMLSPGRRLLNSHWFWLKWVIWSSLVLAVIFWLAFDTAKLGQQQLVSFGGLIMYIVLLFLFSKYPTRVYWRPVLWGIGLQFLLGLLILRTDPGFIAFDWLGRQVQTFLEYTDAGASFVFGEKYKDHFFAFKVLPIVVFFSTVMSMLYYLGLMQWIIRKVGWIMLVTTGSSPIESVVASGNIFVGQTESPLLVRPYLPYITKSELHAIMTAGFSTIAGSVLGAYISFGVPSSHLLTASVMSAPASLAAAKLFWPETEKPKITLKNAMKMESGDSGNLLEAATQGASSSISLVANIAVNLIAFLALLSFMNSALSWFGNMFDYPQLSFELICSYIFMPFSFMMGVEWQDSFMVARLIGYKTFFNEFVAYEHLSKWIHLRKEGGPKFVNGVQQYISIRSEIIATYALCGFANIGSLGIVIGGLTSMAPSRKRDIASGAVRALIAGTVACFMTACIAGILSSTPVDINCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNTF
-
Predicted Molecular Mass
71.4 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
