Complement C8G Protein, Human (N-6*His)
Based on 1 Customer Validation
Complement C8G Protein, Human (N-6*His) is the recombinant human-derived Complement C8G protein, expressed by E. coli, with N-6*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Complement C8G Protein, Human (N-6*His) is the recombinant human-derived Complement C8G protein, expressed by E. coli, with N-6*His tag.
C8G/C8 γ is the γ subunit of the C8 protein of the complement system and is mainly localized in brain astrocytes. The C8 protein is one of five components (C5b, C6, C7, C8, C9) that interact to form the complement cytolytic membrane attack complex (MAC). Can bind to the C5B-7 complex to form the C5B-8 complex. C5-B8 binds to C9 and acts as a catalyst in C9 polymerization. C8γ is unique in that it belongs to the lipocalin family of small secreted proteins and has the ability to bind small hydrophobic ligands. Cysteine residues of C8γ can bind to disulfide bonds of C8α and have inhibitory effects in neuroinflammation. In Alzheimer's disease patients with intense neuroinflammation, C8G levels are higher in brain tissue, cerebrospinal fluid, and plasma. Use of recombinant C8G protein inhibits glial hyperactivation, neuroinflammation, and cognitive decline in animal models of acute and chronic Alzheimer's disease. S1PR2 is a novel interacting protein of C8G, and together they antagonize the proinflammatory effects of S1P in microglia.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
AAI13627.1 (Q21-R202)
-
Gene ID733
-
Molecular Construction
-
N-term
-
6*His
-
Complement C8G (Q21-R202)
Accession # AAI13627.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
rHuComplement component C8 gamma chain/C8G, His; Complement component C8 gamma chain; C8G
-
AA Sequence
QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVNVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
-
Predicted Molecular Mass
20.3 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
