1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Complement factor I Protein, Mouse (HEK293, His)

Complement factor I Protein, Mouse (HEK293, His)

Cat. No.: HY-P703770
Handling Instructions Technical Support

Complement factor I Protein, Mouse (HEK293, His) is the recombinant mouse-derived Complement factor I protein, expressed by HEK293, with C-His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Complement factor I Protein, Mouse (HEK293, His) is the recombinant mouse-derived Complement factor I protein, expressed by HEK293, with C-His tag.

Background

Complement factor I is a trypsin-like serine protease that critically regulates immune responses by controlling all complement pathways. It inactivates these pathways through cleavage of three peptide bonds in the alpha-chain of C3b and two bonds in C4b's alpha-chain. Essential cofactors include fluid-phase factor H and C4BP, plus membrane-bound MCP/CD46 and CR1. On healthy cells, these cofactors enable CFI-mediated C3b degradation to prevent aberrant complement activation, whereas their absence on apoptotic cells/microbes permits C3b-driven complement activation and opsonization. by similar: Functional descriptions are generalized from shared complement regulatory mechanisms.

Species

Mouse

Source

HEK293

Tag

C-8*His

Accession

Q61129 (R19-V603)

Gene ID

12630

Protein Length

Full Length of Mature Protein

Synonyms
Complement factor I; C3B/C4B inactivator; Cfi
AA Sequence

RSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLIYGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV

Predicted Molecular Mass
66.4 kDa
Molecular Weight

Approximately 80-100 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.;≥ 90%, as determined by HPLC.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl (pH 8.0). Normally 8% trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Complement factor I Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Complement factor I Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement factor I Protein, Mouse (HEK293, His)
Cat. No.:
HY-P703770
Quantity:
MCE Japan Authorized Agent: