Complement factor I Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Complement factor I Protein, Mouse (HEK293, His) is the recombinant mouse-derived Complement factor I protein, expressed by HEK293, with C-His tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Complement factor I Protein, Mouse (HEK293, His) is the recombinant mouse-derived Complement factor I protein, expressed by HEK293, with C-His tag.
Background
Complement factor I is a trypsin-like serine protease that critically regulates immune responses by controlling all complement pathways. It inactivates these pathways through cleavage of three peptide bonds in the alpha-chain of C3b and two bonds in C4b's alpha-chain. Essential cofactors include fluid-phase factor H and C4BP, plus membrane-bound MCP/CD46 and CR1. On healthy cells, these cofactors enable CFI-mediated C3b degradation to prevent aberrant complement activation, whereas their absence on apoptotic cells/microbes permits C3b-driven complement activation and opsonization. by similar: Functional descriptions are generalized from shared complement regulatory mechanisms.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q61129 (R19-V603)
-
Gene ID12630
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CFI; C3bINA; Prev. IF; Complement Factor I Heavy Chain; C3B/C4B Inactivator; Light Chain Of Factor I; C3b-INA; Complement Component I; KAF; I Factor (Complement); FI; CFI Protein; Konglutinogen-Activating Factor; ARMD13; C3b-Inactivator; AHUS3; Complement
-
AA Sequence
RSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLIYGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV
-
Predicted Molecular Mass
66.4 kDa
-
Molecular Weight
Approximately 45-53 kDa & 55-65 kDa & 90-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.;≥ 90%, as determined by HPLC.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50mM Tris, 150mM NaCl (pH 8.0). Normally 8% trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)