COPS5 Protein, Human (Sf9, Fc)
The COPS5 protein is a possible protease subunit of the COP9 signalosome complex (CSN) and regulates the ubiquitin conjugation pathway by demethylating the cullin subunit of the SCF-type E3 ligase complex. This activity reduces Ubl ligase activity, affecting complexes such as SCF, CSA, or DDB2. COPS5 Protein, Human (Sf9, Fc) is the recombinant human-derived COPS5 protein, expressed by sf9 insect cells, with C-hFc labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The COPS5 protein is a possible protease subunit of the COP9 signalosome complex (CSN) and regulates the ubiquitin conjugation pathway by demethylating the cullin subunit of the SCF-type E3 ligase complex. This activity reduces Ubl ligase activity, affecting complexes such as SCF, CSA, or DDB2. COPS5 Protein, Human (Sf9, Fc) is the recombinant human-derived COPS5 protein, expressed by sf9 insect cells, with C-hFc labeled tag.
Background
The COPS5 protein serves as the probable protease subunit within the COP9 signalosome complex (CSN), a vital regulator involved in diverse cellular and developmental processes. Operating as a crucial component of the CSN complex, COPS5 plays a central role in the regulation of the ubiquitin conjugation pathway by facilitating the deneddylation of the cullin subunits within SCF-type E3 ligase complexes. This deneddylation activity results in the reduction of Ubl ligase activity, impacting complexes such as SCF, CSA, or DDB2. Moreover, the CSN complex, in association with CK2 and PKD kinases, is implicated in the phosphorylation of various substrates, including p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1, and IRF8. COPS5 likely functions as the catalytic center mediating the cleavage of Nedd8 from cullins within the complex, thereby influencing the regulatory landscape of protein degradation. Its direct interaction with numerous proteins regulated by the CSN complex underscores its key role in mediating cellular processes and highlights its involvement in the proteasomal degradation of BRSK2.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag C-hFc
-
Accession
Q92905 (A2-S334)
-
Gene ID10987
-
Molecular Construction
-
N-term
-
COPS5 (A2-S334)
Accession # Q92905 -
hFc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
COPS5; MOV-34; COP9 Signalosome Subunit 5; Signalosome Subunit 5; JAB1; COP9 (Constitutive Photomorphogenic, Arabidopsis, Homolog) Subunit 5; SGN5; COP9 Constitutive Photomorphogenic Homolog Subunit 5 (Arabidopsis); CSN5; COP9 Constitutive Photomorphogeni
-
AA Sequence
AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
-
Predicted Molecular Mass
64 kDa
-
Molecular Weight
Approximately 33 kDa & 64-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)