CRABP1 Protein, Human

Customer Review

Based on 1 Customer Validation

The CRABP1 protein is present in the cytoplasm and is involved in regulating the entry of retinoic acid into nuclear retinoic acid receptors. As an important molecular player, CRABP1 may mediate the complex process of interaction between retinoic acid and its nuclear receptor. CRABP1 Protein, Human is the recombinant human-derived CRABP1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CRABP1 protein is present in the cytoplasm and is involved in regulating the entry of retinoic acid into nuclear retinoic acid receptors. As an important molecular player, CRABP1 may mediate the complex process of interaction between retinoic acid and its nuclear receptor. CRABP1 Protein, Human is the recombinant human-derived CRABP1 protein, expressed by E. coli , with tag free.

Background

Cellular Retinoic Acid-Binding Protein 1 (CRABP1) is a cytosolic protein known to play a role in regulating the access of retinoic acid to nuclear retinoic acid receptors. As part of the cellular retinoic acid-binding protein family, CRABP1 is involved in intracellular retinoid metabolism and signaling. Specifically, its cytosolic location suggests that it may act as a mediator in controlling the availability of retinoic acid to nuclear retinoic acid receptors, influencing the downstream effects of retinoic acid signaling. This regulatory function underscores the importance of CRABP1 in modulating the cellular responses to retinoic acid, a crucial signaling molecule involved in various physiological processes, including development and differentiation.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CRABP1 (M1-E137)
      Accession # P29762
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CRABP1; CRABP-I; Prev. RBP5; CRABP; Cellular Retinoic Acid-Binding Protein 1; Cellular Retinoic Acid-Binding Protein I; Cellular Retinoic Acid Binding Protein 1; CRABPI

  • AA Sequence

    MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00