Crlf1 Protein, Mouse (HEK293, His, solution)
Based on 1 Customer Validation
Crlf1 protein combines with CLCF1 to form an important neurotrophic cytokine involved in neuronal development. It plays a crucial role in the initiation and maintenance of lactation in neonatal mice and is associated with immune system regulation. Crlf1 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Crlf1 protein, expressed by HEK293 , with His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Crlf1 protein combines with CLCF1 to form an important neurotrophic cytokine involved in neuronal development. It plays a crucial role in the initiation and maintenance of lactation in neonatal mice and is associated with immune system regulation. Crlf1 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Crlf1 protein, expressed by HEK293 , with His labeled tag.
In conjunction with CLCF1, the Crlf1 protein forms a heterodimeric neurotropic cytokine crucial for neuronal development. It plays a vital role in the initiation and/or maintenance of suckling in neonatal mice and is implicated in potential regulatory functions within the immune system. Crlf1 protein exhibits the formation of covalent di- and tetramers, and it engages in the creation of a heteromeric complex with cardiotrophin-like cytokine CLCF1/CLC. This CRLF1-CLCF1 complex serves as a ligand for the ciliary neurotrophic factor receptor/CNTFR. Notably, the CRLF1-CLCF1 heterodimer, along with the tripartite signaling complex formed by CRLF1, CLCF1, and CNTFR, binds SORL1, where the interaction is predominantly mediated by the CRLF1 moiety within this complex. These intricate interactions underscore the multifaceted roles of Crlf1 protein in both neurodevelopmental processes and immune regulation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9JM58 (G40-G425)
-
Protein Length
Partial
-
Synonyms
CRLF1; CLF; Cytokine Receptor Like Factor 1; Cytokine Type 1 Receptor CRLP-1; CLF-1; Cold-Induced Sweating Syndrome; Cytokine Receptor-Like Factor 1; Class I Cytokine Receptor; Cytokine-Like Factor 1; Zcytor5; CISS1; ZcytoR5; CISS; NR6
-
AA Sequence
GAHTAVISPQDPTLLIGSSLQATCSIHGDTPGATAEGLYWTLNGRRLPSELSRLLNTSTLALALANLNGSRQQSGDNLVCHARDGSILAGSCLYVGLPPEKPFNISCWSRNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDVLDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGVCEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGAARGPAG
-
Molecular Weight
Approximately 55-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 8.0 or PBS, pH7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
