Galectin-3/LGALS3 Protein, Mouse (HEK293, His)
Based on 2 publication(s) in Google Scholar
Galectin-3/LGALS3 protein binds IgE and cooperates with integrins α-3 and β-1 to promote endothelial cell migration.It contributes to epithelial cell differentiation and acts as a splicing factor in the nucleus.Galectin-3/LGALS3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Galectin-3/LGALS3 protein binds IgE and cooperates with integrins α-3 and β-1 to promote endothelial cell migration.It contributes to epithelial cell differentiation and acts as a splicing factor in the nucleus.Galectin-3/LGALS3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by HEK293 , with C-His labeled tag.
Background
Galectin-3 (LGALS3) functions as a galactose-specific lectin with the ability to bind IgE and, in collaboration with the alpha-3, beta-1 integrin, participates in the CSPG4-induced stimulation of endothelial cell migration. Alongside DMBT1, it is essential for the terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus, Galectin-3 acts as a pre-mRNA splicing factor. Outside the nucleus, it plays a crucial role in acute inflammatory responses, involving neutrophil activation and adhesion, monocyte macrophage chemoattraction, opsonization of apoptotic neutrophils, and mast cell activation. Furthermore, in coordination with TRIM16, Galectin-3 facilitates the recognition of membrane damage, mobilizing core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. The protein likely forms homo- or heterodimers and interacts with various partners, including DMBT1, CD6, ALCAM, ITGA3, ITGB1, CSPG4, LGALS3BP, LYPD3, ZFTRAF1, and UACA, with the interaction with TRIM16 mediating the autophagy of damaged endomembranes.
Verified Bioactivity
1.Measured by the ability of the immobilized protein to support the adhesion of CTLL-2 cells. The ED50 for this effect is 1.044 μg/mL, corresponding to a specific activity is 957.854 units/mg.
2.Measured by the ability of the immobilized protein to support the adhesion of D10.G4.1 mouse helper T cells. The ED50 for this effect is 1-5 μg/mL.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Nat Commun
ERα blockade in dendritic cells enhances antigen cross-presentation and induces antitumor CD8+ T cell immunity. [Abstract]2026 May 5;17(1):6063. PMID: 42086580 -
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P16110 (A2-I264)
-
Molecular Construction
-
N-term
-
LGALS3 (A2-I264)
Accession # P16110 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
LGALS3; MAC-2; Prev. LGALS2; MAC2; GALIG; Galactoside-Binding Protein; Epididymis Secretory Sperm Binding Protein; MAC-2 Antigen; Advanced Glycation End-Product Receptor 3; Mac-2 Antigen; Lectin, Galactoside-Binding, Soluble, 3; Galectin; Carbohydrate-Binding Protein 35; CBP 35; Galactose-Specific Lectin 3; CBP35; Laminin-Binding Protein; Gal-3; IgE-Binding Protein; GAL3; 35 KDa Lectin; L-31; Lectin L-29; L31; Galectin-3; Galectin 3; GALBP
-
AA Sequence
ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, 300 mM L-Arginine, pH 7.4, 8% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 5 mM EDTA, 2 mM TCEP, pH 7.4, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
