1. Recombinant Proteins
  2. Others
  3. Galectin-3/LGALS3 Protein, Human

Galectin-3/LGALS3 Protein is a type of galactoside-binding lectin that has a high binding affinity for carbohydrates with β-galactoside linkages. Galectin-3/LGALS3 Protein interacts with glycosylated proteins to mediate intercellular interactions and adhesion to the extracellular matrix. Galectin-3/LGALS3 Protein plays various roles, including regulating signaling pathways such as Wnt/β-catenin, affecting cell proliferation and survival, modulating immune functions, and influencing tumor progression. Galectin-3/LGALS3 Protein, Human is a recombinant galectin-3/LGALS3 protein expressed in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    Galectin-3/LGALS3 Protein, Human purchased from MCE. Usage Cited in: J Transl Med. 2024 Jan 6;22(1):32.  [Abstract]

    Myeloid leukemia cells use galectin-1 to block CAR T cells function A, The specific lysis after coculture with U937CD33 cells at a 1:5 in the presence of recombinant galectin 3 protein (20 µg/ml) and galectin-3 specific inhibitor G3-C12 (30 µM).
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    Galectin-3/LGALS3 Protein is a type of galactoside-binding lectin that has a high binding affinity for carbohydrates with β-galactoside linkages. Galectin-3/LGALS3 Protein interacts with glycosylated proteins to mediate intercellular interactions and adhesion to the extracellular matrix. Galectin-3/LGALS3 Protein plays various roles, including regulating signaling pathways such as Wnt/β-catenin, affecting cell proliferation and survival, modulating immune functions, and influencing tumor progression. Galectin-3/LGALS3 Protein, Human is a recombinant galectin-3/LGALS3 protein expressed in E. coli[1][2].

    Background

    Galectin-3/LGALS3 Protein is widely distributed in most tissues and is extensively expressed in specific tissues, with extracellular, membrane-bound, cytoplasmic, and nuclear localization[1].
    The preferred ligand for Galectin-3/LGALS3 Protein is N-acetylglucosamine, which is also the only galectin that contains a conserved N domain and a single carbohydrate recognition domain (CRD). The N domain allows the formation of multimer complexes with proteins that do not bind to carbohydrate targets[1].
    Galectin-3/LGALS3 Protein has a variety of cell functions, including regulating environment-sensitive cell adhesion or splitting, modulating clathrin-independent endocytosis, controlling intracellular signaling through interactions with membrane-bound signal complexes, regulating Wnt/β-catenin signaling, affecting the activity of transcription factors like TTF-1 and STAT, influencing mRNA maturation by affecting spliceosome function, repairing DNA damage, inducing late G1 cell cycle arrest, promoting cell proliferation, and enhancing cell survival through anti-apoptotic effects via Bcl2[1].
    Galectin-3/LGALS3 Protein is involved in immune function. It enhances innate immunity by cleaning up cellular debris, promoting the production of respiratory burst enzymes, serving as a specific phagocytic signal for MerTK, and acting as a warning signal in the central nervous system; additionally, it can promote adaptive immunity by regulating T cell activation[2].
    Galectin-3/LGALS3 Protein is closely related to pathological processes such as tumors, cardiovascular diseases, and acute kidney injury[3][4][5].

    In Vitro

    High expression of Galectin-3/LGALS3 Protein in MI D1 macrophages can promote neutrophil degranulation and regulate myocardial infarction[3].
    Overexpression of Galectin-3/LGALS3 Protein in non-small cell lung cancer may be associated with the occurrence and development of lung cancer[4].
    The lack of expression of Galectin-3/LGALS3 Protein in DCT cells of LGALS3 gene knockdown mice can promote AGE-mediated cell apoptosis[5].
    The lack of expression of Galectin-3/LGALS3 Protein in metastatic melanoma cells where the LGALS3 gene is silenced can inhibit the expression of the pro-tumor gene autotaxin (ENPP2) and the transcription factor NFAT1[6].

    In Vivo

    The lack of expression of the Galectin-3/LGALS3 Protein in LGALS3 mutant (LGALS3 -/-) mice leads to a more diverse circadian rhythm pattern in their eating, drinking, and exercise behaviors[1].
    The expression level of Galectin-3/LGALS3 Protein is elevated in mice with acute kidney injury caused by rhabdomyolysis (RIAKI), thereby providing protection to the distal nephron from damage mediated by AGEs[5].
    Galectin-3/LGALS3 Protein is not expressed in melanoma mice with silenced LGALS3 gene, thereby promoting melanoma growth and metastasis by inhibiting the expression of NFAT1 and autotaxin[6].

    Biological Activity

    Measured by the ability of the immobilized protein to support the adhesion of MOLT-4 human acute lymphoblastic leukemia cells. The ED50 for this effect is 1-3 μg/mL.

    • Measured by the ability of the immobilized protein to support the adhesion of MOLT-4 human acute lymphoblastic leukemia cells. The ED50 for this effect is 2.109 μg/mL, corresponding to a specific activity is 474.158 units/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P17931 (A2-I250)

    Gene ID
    Molecular Construction
    N-term
    LGALS3 (A2-I250)
    Accession # P17931
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rHuGalectin-3; Galectin-3; Gal-3; 35 kDa Lectin; Carbohydrate-Binding Protein 35; CBP 35; Galactose-Specific Lectin 3; Galactoside-Binding Protein; GALBP; IgE-Binding Protein; L-31; Laminin-Binding Protein; Lectin L-29; Mac-2 Antigen; LGALS3; MAC2
    AA Sequence

    ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

    Molecular Weight

    Approximately 29 kDa

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.2 μm filtered solution of 50 mM HEPES, 5% Sucrose, 5% Mannitol, 0.06% Tween 80, pH 7.5.
    2.Lyophilized from a 0.2 μm filtered solution of PBS, 8% trehalose, pH 7.4.
    3.Lyophilized from a 0.2 μm filtered solution of 50 mM HEPES, 150 mMNaCl, 5% Trehalose, pH 7.4.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    Galectin-3/LGALS3 Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    Galectin-3/LGALS3 Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    Galectin-3/LGALS3 Protein, Human
    Cat. No.:
    HY-P70309
    Quantity:
    MCE Japan Authorized Agent: