Copy Link Print Information

Galectin-3/LGALS3 Protein, Human

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

Galectin-3/LGALS3 Protein is a type of galactoside-binding lectin that has a high binding affinity for carbohydrates with β-galactoside linkages. Galectin-3/LGALS3 Protein interacts with glycosylated proteins to mediate intercellular interactions and adhesion to the extracellular matrix. Galectin-3/LGALS3 Protein plays various roles, including regulating signaling pathways such as Wnt/β-catenin, affecting cell proliferation and survival, modulating immune functions, and influencing tumor progression. Galectin-3/LGALS3 Protein, Human is a recombinant galectin-3/LGALS3 protein expressed in E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Galectin-3/LGALS3 Protein, Human
  • Experimental Validation Results for Galectin-3/LGALS3 Protein, Human
  • Experimental Validation Results for Galectin-3/LGALS3 Protein, Human
  • Galectin-3/LGALS3 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Galectin-3/LGALS3 Protein is a type of galactoside-binding lectin that has a high binding affinity for carbohydrates with β-galactoside linkages. Galectin-3/LGALS3 Protein interacts with glycosylated proteins to mediate intercellular interactions and adhesion to the extracellular matrix. Galectin-3/LGALS3 Protein plays various roles, including regulating signaling pathways such as Wnt/β-catenin, affecting cell proliferation and survival, modulating immune functions, and influencing tumor progression. Galectin-3/LGALS3 Protein, Human is a recombinant galectin-3/LGALS3 protein expressed in E. coli[1][2].

Background

Galectin-3/LGALS3 Protein is widely distributed in most tissues and is extensively expressed in specific tissues, with extracellular, membrane-bound, cytoplasmic, and nuclear localization[1].
The preferred ligand for Galectin-3/LGALS3 Protein is N-acetylglucosamine, which is also the only galectin that contains a conserved N domain and a single carbohydrate recognition domain (CRD). The N domain allows the formation of multimer complexes with proteins that do not bind to carbohydrate targets[1].
Galectin-3/LGALS3 Protein has a variety of cell functions, including regulating environment-sensitive cell adhesion or splitting, modulating clathrin-independent endocytosis, controlling intracellular signaling through interactions with membrane-bound signal complexes, regulating Wnt/β-catenin signaling, affecting the activity of transcription factors like TTF-1 and STAT, influencing mRNA maturation by affecting spliceosome function, repairing DNA damage, inducing late G1 cell cycle arrest, promoting cell proliferation, and enhancing cell survival through anti-apoptotic effects via Bcl2[1].
Galectin-3/LGALS3 Protein is involved in immune function. It enhances innate immunity by cleaning up cellular debris, promoting the production of respiratory burst enzymes, serving as a specific phagocytic signal for MerTK, and acting as a warning signal in the central nervous system; additionally, it can promote adaptive immunity by regulating T cell activation[2].
Galectin-3/LGALS3 Protein is closely related to pathological processes such as tumors, cardiovascular diseases, and acute kidney injury[3][4][5].

In Vitro

High expression of Galectin-3/LGALS3 Protein in MI D1 macrophages can promote neutrophil degranulation and regulate myocardial infarction[3].
Overexpression of Galectin-3/LGALS3 Protein in non-small cell lung cancer may be associated with the occurrence and development of lung cancer[4].
The lack of expression of Galectin-3/LGALS3 Protein in DCT cells of LGALS3 gene knockdown mice can promote AGE-mediated cell apoptosis[5].
The lack of expression of Galectin-3/LGALS3 Protein in metastatic melanoma cells where the LGALS3 gene is silenced can inhibit the expression of the pro-tumor gene autotaxin (ENPP2) and the transcription factor NFAT1[6].

In Vivo

The lack of expression of the Galectin-3/LGALS3 Protein in LGALS3 mutant (LGALS3 -/-) mice leads to a more diverse circadian rhythm pattern in their eating, drinking, and exercise behaviors[1].
The expression level of Galectin-3/LGALS3 Protein is elevated in mice with acute kidney injury caused by rhabdomyolysis (RIAKI), thereby providing protection to the distal nephron from damage mediated by AGEs[5].
Galectin-3/LGALS3 Protein is not expressed in melanoma mice with silenced LGALS3 gene, thereby promoting melanoma growth and metastasis by inhibiting the expression of NFAT1 and autotaxin[6].

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of MOLT-4 human acute lymphoblastic leukemia cells. The ED50 for this effect is 1-3 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P17931 (A2-I250)

  • Gene ID
    3958  [NCBI]
  • Molecular Construction
    • N-term
    • LGALS3 (A2-I250)
      Accession # P17931
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    LGALS3; MAC-2; Prev. LGALS2; MAC2; GALIG; Galactoside-Binding Protein; Epididymis Secretory Sperm Binding Protein; MAC-2 Antigen; Advanced Glycation End-Product Receptor 3; Mac-2 Antigen; Lectin, Galactoside-Binding, Soluble, 3; Galectin; Carbohydrate-Bin

  • AA Sequence

    ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of 50 mM HEPES, 5% Sucrose, 5% Mannitol, 0.06% Tween 80, pH 7.5.
2.Lyophilized from a 0.2 μm filtered solution of PBS, 8% trehalose, pH 7.4.
3.Lyophilized from a 0.2 μm filtered solution of 50 mM HEPES, 150 mMNaCl, 5% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Chaudoin TR, et al. Mice lacking galectin-3 (Lgals3) function have decreased home cage movement. BMC Neurosci. 2018 May 2;19(1):27. [Content Brief]

[2]. Demetriou M, et al. Negative regulation of T-cell activation and autoimmunity by Mgat5 N-glycosylation. Nature. 2001 Feb 8;409(6821):733-9. [Content Brief]

[3]. Chalise U, et al. Macrophages secrete murinoglobulin-1 and galectin-3 to regulate neutrophil degranulation after myocardial infarction. Mol Omics. 2022 Mar 28;18(3):186-195. [Content Brief]

[4]. Yoshimura A, et al. Increased expression of the LGALS3 (galectin 3) gene in human non-small-cell lung cancer. Genes Chromosomes Cancer. 2003 Jun;37(2):159-64. [Content Brief]

[5]. Kulow VA, et al. Galectin-3 protects distal convoluted tubules in rhabdomyolysis-induced kidney injury. Pflugers Arch. 2024 Jul 23. [Content Brief]

[6]. Braeuer RR, et al. Galectin-3 contributes to melanoma growth and metastasis via regulation of NFAT1 and autotaxin. Cancer Res. 2012 Nov 15;72(22):5757-66. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of MOLT-4 human acute lymphoblastic leukemia cells. The ED50 for this effect is 2.109 μg/mL, corresponding to a specific activity is 474.158 units/mg.

  • 1/16

    Galectin-3/LGALS3 Protein, Human purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Jan 6;22(1):32. [Abstract]

    Customer Validation
     Myeloid leukemia cells use galectin-1 to block CAR T cells function A, The specific lysis after coculture with U937CD33 cells at a 1:5 in the presence of recombinant galectin 3 protein (20 µg/ml) and galectin-3 specific inhibitor G3-C12 (30 µM).

  • Galectin-3/LGALS3 Protein, Human Product Image
    1/16
  • Experimental Validation Results for Galectin-3/LGALS3 Protein, Human
  • Experimental Validation Results for Galectin-3/LGALS3 Protein, Human
  • Experimental Validation Results for Galectin-3/LGALS3 Protein, Human
  • Galectin-3/LGALS3 Protein, Human Product Image