Galectin-3/LGALS3 Protein, Mouse

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Galectin-3 (LGALS3) is involved in multiple activities, including IgE binding and signaling receptor binding. It negatively regulates T-cell receptor signaling and modulates immune responses by modulating endocytosis and lymphocyte activation. Galectin-3/LGALS3 Protein, Mouse is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Galectin-3 (LGALS3) is involved in multiple activities, including IgE binding and signaling receptor binding. It negatively regulates T-cell receptor signaling and modulates immune responses by modulating endocytosis and lymphocyte activation. Galectin-3/LGALS3 Protein, Mouse is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by E. coli , with tag free.

Background

Galectin-3 (LGALS3) is a multifunctional protein predicted to engage in diverse activities, including IgE binding, advanced glycation end-product receptor activity, and signaling receptor binding. Its involvement in negative regulation of the T cell receptor signaling pathway, endocytosis, and lymphocyte activation underscores its crucial role in modulating immune responses. Positioned in various cellular components, including the external side of the plasma membrane, glial cell projections, and immunological synapses, Galectin-3 operates upstream of processes such as extracellular matrix organization and skeletal system development. Widely expressed in anatomical structures like the alimentary and genitourinary systems, respiratory system, skeleton, and skin, Galectin-3 holds significance in diverse physiological contexts. Notably, it exhibits biased expression in specific tissues, such as the colon and duodenum, suggesting a specialized role in these anatomical regions. Studies on this protein may provide insights into its implications in conditions like asthma and fatty liver disease.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LGALS3 (A2-I264)
      Accession # NP_034835
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LGALS3; MAC-2; Prev. LGALS2; MAC2; GALIG; Galactoside-Binding Protein; Epididymis Secretory Sperm Binding Protein; MAC-2 Antigen; Advanced Glycation End-Product Receptor 3; Mac-2 Antigen; Lectin, Galactoside-Binding, Soluble, 3; Galectin; Carbohydrate-Binding Protein 35; CBP 35; Galactose-Specific Lectin 3; CBP35; Laminin-Binding Protein; Gal-3; IgE-Binding Protein; GAL3; 35 KDa Lectin; L-31; Lectin L-29; L31; Galectin-3; Galectin 3; GALBP

  • AA Sequence

    ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAMI

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00