1. Recombinant Proteins
  2. Others
  3. HMGB1/HMG-1 Protein, Human

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    HMGB1/HMG-1 Protein, Human purchased from MCE. Usage Cited in: Life Sci. 2026 Mar 1:388:124173.  [Abstract]

    HTR-8/SVneo cells were pretreated with SR11302, DPI, or GS-4997 for 24 hours, followed by treatment with 1 μg/mL HMGB1 for 24 hours. Protein levels of galactolectin-9 and TGF-β1 were detected by Western blot.

    HMGB1/HMG-1 Protein, Human purchased from MCE. Usage Cited in: Life Sci. 2026 Mar 1:388:124173.  [Abstract]

    HTR-8/SVneo cells were pretreated with SR11302, DPI, or GS-4997 for 24 hours, followed by treatment with 1 μg/mL HMGB1 for 24 hours. TGF-β levels were detected by ELISA.

    HMGB1/HMG-1 Protein, Human purchased from MCE. Usage Cited in: Mediators Inflamm. 2025 Jul 11:2025:2395557.  [Abstract]

    After stimulating Caco-2 cells with HMGB1 (100 ng/mL) for 24 hours, the concentrations of the following inflammatory factors were detected by ELISA: TNF-α, IL-1β, IL-6, and IL-17.

    HMGB1/HMG-1 Protein, Human purchased from MCE. Usage Cited in: Mediators Inflamm. 2025 Jul 11:2025:2395557.  [Abstract]

    Western blot was used to detect changes in the expression of TLR4, NF-κB, p-NF-κB and GPX4 proteins in Caco-2 cells after 24 hours of stimulation with or without HMGB1 (100 ng/mL; 24 h) and TAK-242.

    HMGB1/HMG-1 Protein, Human purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2024 Aug 5:e2404408.  [Abstract]

    Primary GMEC was treated with 1 µg/mL HMGB1 recombinant protein followed by treatment with 10 nM dairy goat LYZ recombinant protein for 12 h to detect the protein expression levels of p‐NF‐κB‐p65, NF‐κB‐p65, IL‐6, TNFα, and IL‐1β.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    Description

    The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human is the recombinant human-derived HMGB1/HMG-1 protein, expressed by E. coli , with tag free.

    Background

    HMGB1/HMG-1, a multifunctional redox-sensitive protein, exhibits diverse roles across different cellular compartments. Within the nucleus, it stands as a major chromatin-associated non-histone protein, functioning as a DNA chaperone involved in crucial processes such as replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair, and genome stability. Proposed as a universal biosensor for nucleic acids, HMGB1/HMG-1 plays a pivotal role in promoting the host inflammatory response to both sterile and infectious signals, coordinating innate and adaptive immune responses. In the cytoplasm, it serves as a sensor and/or chaperone for immunogenic nucleic acids, activating TLR9-mediated immune responses and mediating autophagy. Released to the extracellular environment, HMGB1/HMG-1 engages with various molecules such as DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS), and lipoteichoic acid (LTA), activating cells through multiple surface receptors. The extracellular HMGB1 exists in different redox states, with fully reduced HMGB1 acting as a chemokine, disulfide HMGB1 as a cytokine, and sulfonyl HMGB1 promoting immunological tolerance. Beyond its immunomodulatory roles, HMGB1/HMG-1 is implicated in proangiogenic activity, platelet activation, neuronal outgrowth signaling via RAGE, and potential involvement in the accumulation of expanded polyglutamine proteins. Its nuclear functions, attributed to fully reduced HMGB1, include association with chromatin, DNA bending, and enhancement of DNA flexibility through looping, facilitating various gene promoter activities. Additionally, HMGB1/HMG-1 may play roles in nucleotide excision repair, mismatch repair, base excision repair, double-strand break repair, V(D)J recombination, displacement of histone H1, restructuring nucleosomes, enhancing transcription factor binding, and modulating the telomerase complex. The intricate functions of HMGB1/HMG-1 highlight its significance in diverse cellular processes.

    Biological Activity

    Measured by its ability to down regulate the expression of TNF-α by THP-1 cells treated with 2 μg/mL LPS.

    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P09429 (M1-F89)

    Gene ID
    Molecular Construction
    N-term
    HMGB1 (M1-F89)
    Accession # P09429
    C-term
    Protein Length

    Partial

    Synonyms
    High Mobility Group Protein B1; High Mobility Group Protein 1; HMG-1; HMGB1; HMG1
    AA Sequence

    MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF

    Molecular Weight

    Approximately 14 kDa

    Purity
    • ≥ 90%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 500 mM NaCl, 0.5 mM DTT, pH 7.9.
    2.Lyophilized from a 0.22 μm filtered solution of 50 mM HEPS, 500 mM NaCl, 0.5 mM DTT, pH 8.0.
    3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation

    HMGB1/HMG-1 Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    HMGB1/HMG-1 Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    HMGB1/HMG-1 Protein, Human
    Cat. No.:
    HY-P70570
    Quantity:
    MCE Japan Authorized Agent: