CRTAM/CD355 Protein, Canine (HEK293, His)
The CRTAM/CD355 protein is a key mediator of heterophilic intercellular adhesion and complexly regulates the activation, differentiation, and tissue retention of T cell subsets. Its interaction with CADM1 promotes NK cell cytotoxicity and CD8+ T cell secretion of IFNG, thus contributing to NK cell-mediated tumor rejection. CRTAM/CD355 Protein, Canine (HEK293, His) is the recombinant canine-derived CRTAM/CD355 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CRTAM/CD355 protein is a key mediator of heterophilic intercellular adhesion and complexly regulates the activation, differentiation, and tissue retention of T cell subsets. Its interaction with CADM1 promotes NK cell cytotoxicity and CD8+ T cell secretion of IFNG, thus contributing to NK cell-mediated tumor rejection. CRTAM/CD355 Protein, Canine (HEK293, His) is the recombinant canine-derived CRTAM/CD355 protein, expressed by HEK293 , with C-His labeled tag.
Background
CRTAM/CD355 Protein serves as a crucial mediator of heterophilic cell-cell adhesion, intricately regulating the activation, differentiation, and tissue retention of various T-cell subsets. Its interaction with CADM1 plays a pivotal role in promoting natural killer (NK) cell cytotoxicity, as well as IFNG/interferon-gamma secretion by CD8+ T-cells both in vitro and in vivo, contributing to NK cell-mediated rejection of CADM1-expressing tumors. CRTAM also modulates CD8+ T-cell proliferation in response to T-cell receptor (TCR) activation and, through interaction with SCRIB, facilitates the late phase of cellular polarization in a subset of CD4+ T-cells, regulating TCR-mediated proliferation and cytokine production. Moreover, CRTAM's interaction with CADM1 on CD8+ dendritic cells regulates the retention of activated CD8+ T-cells within draining lymph nodes. Essential for the intestinal retention of intraepithelial T-cell subsets, CRTAM further promotes adhesion to gut-associated CD103+ dendritic cells, facilitating the expression of gut-homing and adhesion molecules on T-cells. As a monomer that may form homodimers, CRTAM's intricate interactions, particularly with CADM1 and SCRIB, highlight its central role in orchestrating diverse cellular functions critical for immune responses and tissue homeostasis. Further exploration of these interactions will shed light on the precise mechanisms underlying CRTAM's regulatory functions.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-8*His
-
Accession
E2QWY2 (F18-G287)
-
Gene ID/
-
Molecular Construction
-
N-term
-
CRTAM (F18-G287)
Accession # E2QWY2 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CRTAM; Cytotoxic And Regulatory T-Cell Molecule; Cytotoxic And Regulatory T Cell Molecule; Class I MHC Restricted T Cell Associated Molecule; CD355; CD355 Antigen; Class-I MHC-Restricted T-Cell-Associated Molecule
-
AA Sequence
FLTNHTETVTVEEGQTLTLNCVVSPEKTISLQWLAPSGFTIFLNEHPALQNSKYQLLHHSTNQLSISVLNVSQRDEGVYKCLHYSNSVRTKEVKVMVLATPSMPTLEASVIRTQNGKEHVTLRCSTVRSKPPPQITWILGNDIELYGETHHEFEMDGKKCNSSSLLRVHTYGKNSTVNCIIRHKGLQGRKLVAPFRFEDLVTDQETASDAPEKSSPSSQDPQQPASTVAVMEDSSTTESDKEEKEQTTQDPDLATEANLQYLGVVRKKNG
-
Predicted Molecular Mass
31.2 kDa
-
Molecular Weight
Approximately 55-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)