CSTL1 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
Cystatin-like protein 1 (CSTL1) is a member of the cystatin family. CSTL1 Protein, Human (HEK293, Fc) is the recombinant human-derived CSTL1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Cystatin-like protein 1 (CSTL1) is a member of the cystatin family. CSTL1 Protein, Human (HEK293, Fc) is the recombinant human-derived CSTL1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CSTL1 Protein is a type 2 cystatin-like protein. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The specific function of this protein has not been determined. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9H114 (A20-R145)
-
Gene ID128817 [NCBI]
-
Molecular Construction
-
N-term
-
CSTL1 (A20-R145)
Accession # Q9H114 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CSTL1; DJ322G13.4; Cystatin Like 1; CTES1; Cystatin-Like 1; RCET11
-
AA Sequence
AKLGHFQRWEGFQQKLMSKKNMNSTLNFFIQSYNNASNDTYLYRVQRLIRSQMQLTTGVEYIVTVKIGWTKCKRNDTSNSSCPLQSKKLRKSLICESLIYTMPWINYFQLWNNSCLEAEHVGRNLR
-
Molecular Weight
Approximately 45-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)