CTLA-4 Protein, Canine (HEK293, His)

CTLA-4 protein inhibits T-cell responses as a critical negative regulator, with a stronger affinity for CD80 and CD86 than CD28. This affinity allows CTLA-4 to effectively suppress T-cell activation and regulate immune responses, maintaining a delicate equilibrium in T-cell-mediated immunity. CTLA-4 Protein, Canine (HEK293, His) is the recombinant canine-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

CTLA-4 protein functions as a critical inhibitory receptor, playing a pivotal role as a major negative regulator in T-cell responses. The distinguishing feature of CTLA-4 lies in its significantly stronger affinity for its natural B7 family ligands, CD80 and CD86, compared to the affinity of their corresponding stimulatory coreceptor, CD28. This heightened affinity enables CTLA-4 to effectively counterbalance and suppress T-cell activation, contributing to the intricate regulation of immune responses. The dynamic interplay between CTLA-4 and its ligands underscores its significance in fine-tuning the immune system and maintaining a delicate equilibrium between activation and inhibition in T-cell-mediated immunity.

Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED₅₀ for this effect is 76.8 ng/mL, corresponding to a specific activity is 1.3×10⁴ U/mg.

• 
  Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED₅₀ for this effect is 76.8 ng/mL, corresponding to a specific activity is 1.3×10⁴ U/mg.

Canine

HEK293

C-6*His

Q9GKP2 (K36-D161)

403696  [NCBI]

Partial

KGMHVAQPAVVLASSRGVASFVCEYGSSGNAAEVRVTVLRQAGSQMTEVCAATYTVEDELAFLDDSTCTGTSSGNKVNLTIQGLRAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIDPEPCPDSD

Approximately 19-25 kDa due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/umuc3-cell.html  [Content Brief]