Copy Link Print Information

CTLA-4 Protein, Canine (HEK293, His)

Customer Review

Based on 1 Customer Validation

CTLA-4 protein inhibits T-cell responses as a critical negative regulator, with a stronger affinity for CD80 and CD86 than CD28. This affinity allows CTLA-4 to effectively suppress T-cell activation and regulate immune responses, maintaining a delicate equilibrium in T-cell-mediated immunity. CTLA-4 Protein, Canine (HEK293, His) is the recombinant canine-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CTLA-4 Protein, Canine (HEK293, His)
  • Experimental Validation Results for CTLA-4 Protein, Canine (HEK293, His)
  • CTLA-4 Protein, Canine (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CTLA-4 protein inhibits T-cell responses as a critical negative regulator, with a stronger affinity for CD80 and CD86 than CD28. This affinity allows CTLA-4 to effectively suppress T-cell activation and regulate immune responses, maintaining a delicate equilibrium in T-cell-mediated immunity. CTLA-4 Protein, Canine (HEK293, His) is the recombinant canine-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.

Background

CTLA-4 protein functions as a critical inhibitory receptor, playing a pivotal role as a major negative regulator in T-cell responses. The distinguishing feature of CTLA-4 lies in its significantly stronger affinity for its natural B7 family ligands, CD80 and CD86, compared to the affinity of their corresponding stimulatory coreceptor, CD28. This heightened affinity enables CTLA-4 to effectively counterbalance and suppress T-cell activation, contributing to the intricate regulation of immune responses. The dynamic interplay between CTLA-4 and its ligands underscores its significance in fine-tuning the immune system and maintaining a delicate equilibrium between activation and inhibition in T-cell-mediated immunity.

Verified Bioactivity

Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED50 for this effect is 76.8 ng/mL, corresponding to a specific activity is 1.3×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED50 for this effect is 76.8 ng/mL, corresponding to a specific activity is 1.3×104 U/mg.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9GKP2 (K36-D161)

  • Gene ID
    403696  [NCBI]
  • Molecular Construction
    • N-term
    • CTLA-4 (K36-D161)
      Accession # Q9GKP2
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CTLA4; Celiac Disease 3; Prev. CELIAC3; Cytotoxic T Lymphocyte Associated Antigen 4 Short Spliced Form; Prev. IDDM12; Cytotoxic T-Lymphocyte-Associated Serine Esterase-4; CTLA-4; Cytotoxic T-Lymphocyte-Associated Protein 4; CD152; Cytotoxic T-Lymphocyte A

  • AA Sequence

    KGMHVAQPAVVLASSRGVASFVCEYGSSGNAAEVRVTVLRQAGSQMTEVCAATYTVEDELAFLDDSTCTGTSSGNKVNLTIQGLRAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIDPEPCPDSD

  • Molecular Weight

    Approximately 19-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED50 for this effect is 76.8 ng/mL, corresponding to a specific activity is 1.3×104 U/mg.

  • CTLA-4 Protein, Canine (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CTLA-4 Protein, Canine (HEK293, His)
  • Experimental Validation Results for CTLA-4 Protein, Canine (HEK293, His)
  • CTLA-4 Protein, Canine (HEK293, His) Product Image