CTLA-4 Protein, Mouse (Biotinylated, HEK293, His-Avi)
CTLA-4 is a key inhibitory receptor that serves as a major negative regulator of T cell responses in immune regulation. Its unique property is that its affinity to B7 ligands (CD80/CD86) is significantly higher than that of CD28. CTLA-4 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CTLA-4 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CTLA-4 is a key inhibitory receptor that serves as a major negative regulator of T cell responses in immune regulation. Its unique property is that its affinity to B7 ligands (CD80/CD86) is significantly higher than that of CD28. CTLA-4 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CTLA-4 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
CTLA-4, a pivotal inhibitory receptor, acts as a primary negative regulator in T-cell responses, exerting its influence within the intricate network of immune modulation. This regulatory function arises from the distinct property of CTLA-4, showcasing significantly heightened affinity for its natural B7 family ligands, CD80 and CD86, in comparison to the cognate stimulatory coreceptor CD28. The homodimeric structure of CTLA-4, intricately linked by disulfide bonds, underscores its role as a molecular sentinel in immune regulation. Functionally, CTLA-4 binds avidly to CD80/B7-1 and CD86/B7.2, competitively engaging with these ligands to suppress T-cell activation and finely tune immune responses. Additionally, CTLA-4 interacts with ICOSLG, contributing to its multifaceted engagement in immune checkpoint pathways.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P09793 (E36-F162)
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CTLA4; Celiac Disease 3; Prev. CELIAC3; Cytotoxic T Lymphocyte Associated Antigen 4 Short Spliced Form; Prev. IDDM12; Cytotoxic T-Lymphocyte-Associated Serine Esterase-4; CTLA-4; Cytotoxic T-Lymphocyte-Associated Protein 4; CD152; Cytotoxic T-Lymphocyte A
-
AA Sequence
EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF
-
Predicted Molecular Mass
17.6 kDa
-
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
