1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CTLA-4
  5. CTLA-4 Protein, Mouse (Biotinylated, HEK293, His-Avi)

CTLA-4 Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78889
Instrucciones de manejo Technical Support

CTLA-4 is a key inhibitory receptor that serves as a major negative regulator of T cell responses in immune regulation. Its unique property is that its affinity to B7 ligands (CD80/CD86) is significantly higher than that of CD28. CTLA-4 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CTLA-4 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
25 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Obtener un presupuesto 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Obtener un presupuesto  
Synthetic products have potential research and development risk.

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

CTLA-4 is a key inhibitory receptor that serves as a major negative regulator of T cell responses in immune regulation. Its unique property is that its affinity to B7 ligands (CD80/CD86) is significantly higher than that of CD28. CTLA-4 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CTLA-4 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

CTLA-4, a pivotal inhibitory receptor, acts as a primary negative regulator in T-cell responses, exerting its influence within the intricate network of immune modulation. This regulatory function arises from the distinct property of CTLA-4, showcasing significantly heightened affinity for its natural B7 family ligands, CD80 and CD86, in comparison to the cognate stimulatory coreceptor CD28. The homodimeric structure of CTLA-4, intricately linked by disulfide bonds, underscores its role as a molecular sentinel in immune regulation. Functionally, CTLA-4 binds avidly to CD80/B7-1 and CD86/B7.2, competitively engaging with these ligands to suppress T-cell activation and finely tune immune responses. Additionally, CTLA-4 interacts with ICOSLG, contributing to its multifaceted engagement in immune checkpoint pathways.

Actividad biológica

Immobilized Biotinylated Mouse CTLA-4 His-Avi at 1 μg/mL (100 μL/well) on Streptavidin precoated (0.5 μg/well) plate can bind Ipilimumab with a linear range of 5-40 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-His

Accession

P09793 (E36-F162)

Gene ID
Protein Length

Partial

Conjugation

Biotin

Synonyms
CTLA4; CD152
AA Sequence

EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF

Peso molecular

27-33 kDa

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

CTLA-4 Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
CTLA-4 Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78889
Cantidad:
MCE Japan Authorized Agent: