Copy Link Print Information

Decorin/PGS2 Protein, Rat (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Decorin/PGS2 protein is involved in regulating extracellular matrix dynamics, affecting the rate of fibril formation and participating in rat cervical dilation. It has versatile binding properties, interacting with type I and type II collagen, fibronectin, and TGF-β, suggesting involvement in a variety of cellular processes. Decorin/PGS2 Protein, Rat (HEK293, His) is the recombinant rat-derived Decorin/PGS2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Decorin/PGS2 Protein, Rat (HEK293, His)
  • Experimental Validation Results for Decorin/PGS2 Protein, Rat (HEK293, His)
  • Decorin/PGS2 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Decorin/PGS2 protein is involved in regulating extracellular matrix dynamics, affecting the rate of fibril formation and participating in rat cervical dilation. It has versatile binding properties, interacting with type I and type II collagen, fibronectin, and TGF-β, suggesting involvement in a variety of cellular processes. Decorin/PGS2 Protein, Rat (HEK293, His) is the recombinant rat-derived Decorin/PGS2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Decorin/PGS2 Protein is implicated in influencing the rate of fibril formation, suggesting a role in the modulation of extracellular matrix dynamics. Additionally, it may play a part in the dilatation of the rat cervix. The protein exhibits a versatile binding profile, interacting with type I and type II collagen, fibronectin, and TGF-beta, indicating its involvement in diverse cellular processes. Furthermore, Decorin forms a ternary complex with MFAP2 and ELN, highlighting its engagement in complex molecular interactions within the extracellular environment. Its interaction with DPT further underscores its involvement in the regulation of structural and signaling components. A comprehensive exploration of Decorin's functions and its interplay with various molecular partners could provide valuable insights into its multifaceted role in extracellular matrix biology and tissue physiology.

Verified Bioactivity

Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Recombinant Rat Decorin can significantly delay the rate of collagen fibrillogenesis.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Biochemical Activity Assay

    Bioactivity - Biochemical Activity Assay

    Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Recombinant Rat Decorin can significantly delay the rate of collagen fibrillogenesis.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q01129 (G17-K354)

  • Gene ID
    29139  [NCBI]
  • Molecular Construction
    • N-term
    • PGS2 (G17-K354)
      Accession # Q01129
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    DCN; Decorin Proteoglycan; Decorin; Decorin Isoform 3; SLRR1B; Decorin Isoform 4; Bone Proteoglycan II; DKFZp686J19238; DSPG2; PG-S2; PG40; CSCD; Dermatan Sulphate Proteoglycans II; PGII; Small Leucine-Rich Protein 1B; PGS2; Proteoglycan Core Protein

  • AA Sequence

    GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWEFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLKELPEKLPKTLQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIENGALQGMKGLGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLYSNPVRYWQIHPHTFRCVFGRSTIQLGNYK

  • Molecular Weight

    Approximately 43-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Recombinant Rat Decorin can significantly delay the rate of collagen fibrillogenesis.

  • Decorin/PGS2 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Decorin/PGS2 Protein, Rat (HEK293, His)
  • Experimental Validation Results for Decorin/PGS2 Protein, Rat (HEK293, His)
  • Decorin/PGS2 Protein, Rat (HEK293, His) Product Image