Dectin-1/CLEC7A Protein, Mouse (HEK293, Fc)

Dectin-1/CLEC7A acts as a lectin and specifically recognizes β-1,3-linked and β-1,6-linked glucans in bacterial and fungal cell walls. Dectin-1/CLEC7A is critical for Toll-like receptor 2 (TLR2)-mediated inflammation by recruiting SYK through its immunoreceptor tyrosine-based activation motif (ITAM), thereby activating NF-kappa-B. Dectin-1/CLEC7A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-hFc labeled tag.

The Dectin-1/CLEC7A protein operates as a lectin, specifically recognizing beta-1,3-linked and beta-1,6-linked glucans found in the cell walls of pathogenic bacteria and fungi. Essential for the Toll-like receptor 2 (TLR2)-mediated inflammatory response, Dectin-1/CLEC7A activates NF-kappa-B by recruiting spleen tyrosine kinase (SYK) through its immunoreceptor tyrosine-based activation motif (ITAM). This initiates a signaling cascade involving the CARD domain-BCL10-MALT1 (CBM) signalosomes, leading to the activation of NF-kappa-B and MAP kinase p38 pathways. Consequently, this cascade stimulates the expression of genes encoding pro-inflammatory cytokines and chemokines. Additionally, Dectin-1/CLEC7A enhances cytokine production in macrophages and dendritic cells, mediates the production of reactive oxygen species, and facilitates the phagocytosis of C. albicans conidia. Notably, it binds to T-cells independently of their surface glycans, playing a role in T-cell activation, stimulating T-cell proliferation, and inducing SCIMP phosphorylation upon beta-glucan binding. The protein forms homodimers and interacts with SYK, contributing to leukocyte activation in the presence of fungal pathogens.

Mouse

HEK293

N-hFc

Q6QLQ4 (G71-L244)

56644  [NCBI]

Extracellular Domain

GHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL

50-65 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.