Dectin-1/CLEC7A Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
Dectin-1/CLEC7A acts as a lectin and specifically recognizes β-1,3-linked and β-1,6-linked glucans in bacterial and fungal cell walls. Dectin-1/CLEC7A is critical for Toll-like receptor 2 (TLR2)-mediated inflammation by recruiting SYK through its immunoreceptor tyrosine-based activation motif (ITAM), thereby activating NF-kappa-B. Dectin-1/CLEC7A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Dectin-1/CLEC7A acts as a lectin and specifically recognizes β-1,3-linked and β-1,6-linked glucans in bacterial and fungal cell walls. Dectin-1/CLEC7A is critical for Toll-like receptor 2 (TLR2)-mediated inflammation by recruiting SYK through its immunoreceptor tyrosine-based activation motif (ITAM), thereby activating NF-kappa-B. Dectin-1/CLEC7A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-hFc labeled tag.
Background
The Dectin-1/CLEC7A protein operates as a lectin, specifically recognizing beta-1,3-linked and beta-1,6-linked glucans found in the cell walls of pathogenic bacteria and fungi. Essential for the Toll-like receptor 2 (TLR2)-mediated inflammatory response, Dectin-1/CLEC7A activates NF-kappa-B by recruiting spleen tyrosine kinase (SYK) through its immunoreceptor tyrosine-based activation motif (ITAM). This initiates a signaling cascade involving the CARD domain-BCL10-MALT1 (CBM) signalosomes, leading to the activation of NF-kappa-B and MAP kinase p38 pathways. Consequently, this cascade stimulates the expression of genes encoding pro-inflammatory cytokines and chemokines. Additionally, Dectin-1/CLEC7A enhances cytokine production in macrophages and dendritic cells, mediates the production of reactive oxygen species, and facilitates the phagocytosis of C. albicans conidia. Notably, it binds to T-cells independently of their surface glycans, playing a role in T-cell activation, stimulating T-cell proliferation, and inducing SCIMP phosphorylation upon beta-glucan binding. The protein forms homodimers and interacts with SYK, contributing to leukocyte activation in the presence of fungal pathogens.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
Q6QLQ4 (G71-L244)
-
Molecular Construction
-
N-term
-
hFc
-
CLEC7A (G71-L244)
Accession # Q6QLQ4 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC7A; CDNA FLJ59887, Moderately Similar To Homo Sapiens C-Type Lectin Domain Family 7, Member A (CLEC7A), Transcript Variant 4, MRNA; Prev. CLECSF12; C-Type Lectin Domain Containing 7A Transcript Variant 7; C-Type Lectin Domain Family 7 Member A; C-Type
-
AA Sequence
GHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL
-
Predicted Molecular Mass
46.1 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)