DNase1L3 Protein, Mouse (His)
Based on 1 publication(s) in Google Scholar
DNase1L3 protein has DNA hydrolytic activity and can effectively cleave single-stranded and double-stranded DNA to generate 3'-OH terminal fragments. It cleaves chromatin into nucleosomal units and participates in internucleosomal DNA fragmentation during apoptosis and necrosis. DNase1L3 Protein, Mouse (His) is the recombinant mouse-derived DNase1L3 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
DNase1L3 protein has DNA hydrolytic activity and can effectively cleave single-stranded and double-stranded DNA to generate 3'-OH terminal fragments. It cleaves chromatin into nucleosomal units and participates in internucleosomal DNA fragmentation during apoptosis and necrosis. DNase1L3 Protein, Mouse (His) is the recombinant mouse-derived DNase1L3 protein, expressed by E. coli , with C-6*His labeled tag.
DNase1L3 Protein exhibits DNA hydrolytic activity, proficient in both single- and double-stranded DNA cleavage, generating DNA fragments with 3'-OH ends. Capable of cleaving chromatin into nucleosomal units, it participates in internucleosomal DNA fragmentation (INDF) during apoptosis and necrosis. Its roles in apoptosis encompass myogenic and neuronal differentiation, as well as BCR-mediated clonal deletion of self-reactive B cells. Active on chromatin in apoptotic cell-derived membrane-coated microparticles, DNase1L3 suppresses anti-DNA autoimmunity. Alongside DNASE1, it plays a pivotal role in degrading neutrophil extracellular traps (NETs), composed mainly of DNA fibers, released by neutrophils to bind pathogens during inflammation. The concerted action of DNASE1 and DNASE1L3 in breaking down intravascular NETs is crucial for preventing the formation of clots that could obstruct blood vessels and lead to organ damage following inflammation.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cancer Cell
DNASE1L3-expressing dendritic cells promote CD8+ T cell function and anti-PD-(L)1 therapy efficacy by degrading neutrophil extracellular traps. [Abstract]2025 Sep 8;43(9):1758-1775.e8. PMID: 40816293
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
O55070 (L26-S310)
-
Molecular Construction
-
N-term
-
DNase1L3 (L26-S310)
Accession # O55070 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DNASE1L3; Deoxyribonuclease Gamma; Deoxyribonuclease 1L3; Liver And Spleen DNase; DNAS1L3; DNase I-Like 3; LSD; DNaseY; DNase Gamma; DHP2; LS-DNase; Deoxyribonuclease I-Like III; D3; Deoxyribonuclease I Like 3; DNase I Homolog Protein DHP2; DNase I Homolo
-
AA Sequence
LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQSSRAFTNNRKSVSLKKRKKGNRS
-
Predicted Molecular Mass
40.1 kDa
-
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6%trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
