dUTPase/DUT Protein, Human
Deoxyuridine 5'-triphosphate nucleotidohydrolase (DUT) is an essential enzyme of nucleotide metabolism, as DUT hydrolyzes dUTP to dUMP and pyrophosphate, preventing uracil misincorporation into DNA efficiently and provides dUMP for thymidylate biosynthesis. DUT also prevents dimerization of PPAR and retinoid X receptor and is essential for embryonic development as well. dUTPase/DUT Protein, Human is the recombinant human-derived dUTPase/DUT protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Deoxyuridine 5'-triphosphate nucleotidohydrolase (DUT) is an essential enzyme of nucleotide metabolism, as DUT hydrolyzes dUTP to dUMP and pyrophosphate, preventing uracil misincorporation into DNA efficiently and provides dUMP for thymidylate biosynthesis. DUT also prevents dimerization of PPAR and retinoid X receptor and is essential for embryonic development as well. dUTPase/DUT Protein, Human is the recombinant human-derived dUTPase/DUT protein, expressed by E. coli , with tag free.
Background
Deoxyuridine 5'-triphosphate nucleotidohydrolase (DUT) is an essential enzyme of nucleotide metabolism, as DUT forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate, preventing uracil misincorporation into DNA efficiently and at the same time provides dUMP, the substrate for de novo thymidylate biosynthesis. Alternative splicing of DUT leads to different isoforms that localize to either the mitochondrion or nucleus.
DUT also inhibits peroxisome proliferator-activated receptor (PPAR) activity by binding of its N-terminal to PPAR, preventing dimerization of PPAR and retinoid X receptor. DUT is essential for embryonic development as well [1][2][3]
.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P33316-2 (M1-N164)
-
Molecular Construction
-
N-term
-
dUTPase (M1-N164)
Accession # P33316-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
DUT; DUTP Diphosphatase; Deoxyuridine Triphosphatase; Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; DUTPase; DUTP Nucleotidohydrolase; DUTP Pyrophosphatase; BMFDMS; Deoxyuridine 5'-Triphosphate Nucleotidohydrolase, Mitochondrial
-
AA Sequence
MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
-
Predicted Molecular Mass
17.7 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)