1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. dUTPase/DUT Protein, Human

Deoxyuridine 5'-triphosphate nucleotidohydrolase (DUT) is an essential enzyme of nucleotide metabolism, as DUT hydrolyzes dUTP to dUMP and pyrophosphate, preventing uracil misincorporation into DNA efficiently and provides dUMP for thymidylate biosynthesis. DUT also prevents dimerization of PPAR and retinoid X receptor and is essential for embryonic development as well. dUTPase/DUT Protein, Human is the recombinant human-derived dUTPase/DUT protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Deoxyuridine 5'-triphosphate nucleotidohydrolase (DUT) is an essential enzyme of nucleotide metabolism, as DUT hydrolyzes dUTP to dUMP and pyrophosphate, preventing uracil misincorporation into DNA efficiently and provides dUMP for thymidylate biosynthesis. DUT also prevents dimerization of PPAR and retinoid X receptor and is essential for embryonic development as well. dUTPase/DUT Protein, Human is the recombinant human-derived dUTPase/DUT protein, expressed by E. coli , with tag free.

Background

Deoxyuridine 5'-triphosphate nucleotidohydrolase (DUT) is an essential enzyme of nucleotide metabolism, as DUT forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate, preventing uracil misincorporation into DNA efficiently and at the same time provides dUMP, the substrate for de novo thymidylate biosynthesis. Alternative splicing of DUT leads to different isoforms that localize to either the mitochondrion or nucleus.
DUT also inhibits peroxisome proliferator-activated receptor (PPAR) activity by binding of its N-terminal to PPAR, preventing dimerization of PPAR and retinoid X receptor. DUT is essential for embryonic development as well [1][2][3]
.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P33316-2 (M1-N164)

Gene ID
Molecular Construction
N-term
dUTPase (M1-N164)
Accession # P33316-2
C-term
Protein Length

Full Length of Isoform-2

Synonyms
rHuDeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial/DUT; Deoxyuridine 5'-Triphosphate Nucleotidohydrolase Mitochondrial; dUTPase; dUTP Pyrophosphatase; DUT
AA Sequence

MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

Molecular Weight

Approximately 18.0 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

dUTPase/DUT Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

dUTPase/DUT Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
dUTPase/DUT Protein, Human
Cat. No.:
HY-P70026
Quantity:
MCE Japan Authorized Agent: