EDNRA Protein, Human (Cell-Free, C-His)
EDNRA Protein, a receptor for endothelin-1, activates a phosphatidylinositol-calcium second messenger system through association with G proteins. Its binding affinities follow the order: ET1 > ET2 >> ET3. Additionally, EDNRA interacts with HDAC7 and KAT5. EDNRA Protein, Human (Cell-Free, C-His) is the recombinant human-derived EDNRA protein, expressed by E. coli Cell-free, with C-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
EDNRA Protein, a receptor for endothelin-1, activates a phosphatidylinositol-calcium second messenger system through association with G proteins. Its binding affinities follow the order: ET1 > ET2 >> ET3. Additionally, EDNRA interacts with HDAC7 and KAT5. EDNRA Protein, Human (Cell-Free, C-His) is the recombinant human-derived EDNRA protein, expressed by E. coli Cell-free, with C-10*His labeled tag.
EDNRA, a pivotal player in cellular signaling, operates as a receptor for endothelin-1, executing its actions through G proteins and initiating a phosphatidylinositol-calcium second messenger system. This receptor exhibits varying binding affinities, with ET1 holding the highest affinity, followed by ET2 and ET3. Beyond its canonical functions in endothelin signaling, EDNRA engages in molecular interactions, forming complexes with HDAC7 and KAT5, potentially contributing to intricate cellular regulatory networks. The convergence of endothelin-1 signaling and protein interactions highlights the multifaceted role of EDNRA in orchestrating diverse cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag C-10*His
-
Accession
P25101 (D21-N427)
-
Gene ID1909
-
Molecular Construction
-
N-term
-
EDNRA (D21-N427)
Accession # P25101 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
EDNRA; ETA; Endothelin Receptor Type A; Endothelin-1-Specific Receptor; HET-AR; Endothelin Receptor Subtype A; ETA-R; G Protein-Coupled Receptor; ET-A; ETAR; Endothelin-1 Receptor; MFDA; ETRA
-
AA Sequence
DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
-
Predicted Molecular Mass
49.9 kDa
-
Molecular Weight
Approximately 49.9 kDa,based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
