EGLN1 Protein, Human (246a.a, His)

Customer Review

Based on 1 Customer Validation

EGLN1 Protein, Human (246a.a, His) is the recombinant human-derived EGLN1, expressed by E. coli , with His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

EGLN1 Protein, Human (246a.a, His) is the recombinant human-derived EGLN1, expressed by E. coli , with His labeled tag.

Background

EGLN1 is a cellular oxygen sensor that catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins under normoxic conditions. It hydroxylates specific proline residues in each oxygen-dependent degradation domain (ODD) of HIF1A (N-terminal NODD and C-terminal CODD) and similarly acts on HIF2A, with a preference for the CODD site in both HIF1A and HIF1B. Hydroxylated HIFs are targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxia, attenuated hydroxylation allows HIFs to escape degradation, translocate to the nucleus, heterodimerize with HIF1B, and upregulate hypoxia-inducible genes. As the most critical isozyme under normoxia, EGLN1 regulates HIF1 stability and participates in hypoxia-influenced processes like angiogenesis in retinal and cardiac functions. Target proteins are preferentially recognized through a LXXLAP motif.

Verified Bioactivity

In the presence of α-ketoglutarate, PHD2 can bind to the F-P564 peptide; the F-P564 peptide is a fluorescently labeled polypeptide (mimicking the proline site sequence of HIF-1α). In the experiment, the binding efficiency was detected by fluorescence polarization assay, and the change in fluorescence signal can indirectly reflect the activity of PHD2.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    EGLN1; HPH-2; Prev. C1orf12; Hypoxia-Inducible Factor-Proline Dioxygenase; PHD2; Egl-9 Family Hypoxia-Inducible Factor 1; ZMYND6; Egl Nine Homolog 1 (C. Elegans); HIFPH2; EGL Nine (C.Elegans) Homolog 1; SM-20; HIF Prolyl Hydroxylase 2; Prolyl Hydroxylase

  • AA Sequence

    PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

  • Predicted Molecular Mass

    28.4 kDa

  • Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of PBS.
2.Supplied as a 0.22 μm filtered solution of 25 mM Tris-HCl, pH 7.5, 150 mM NaCl.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00