1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. EGLN1 Protein, Human (246a.a, His)

EGLN1 Protein, Human (246a.a, His) is the recombinant human-derived EGLN1, expressed by E. coli , with His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EGLN1 Protein, Human (246a.a, His) is the recombinant human-derived EGLN1, expressed by E. coli , with His labeled tag.

Background

EGLN1 is a cellular oxygen sensor that catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins under normoxic conditions. It hydroxylates specific proline residues in each oxygen-dependent degradation domain (ODD) of HIF1A (N-terminal NODD and C-terminal CODD) and similarly acts on HIF2A, with a preference for the CODD site in both HIF1A and HIF1B. Hydroxylated HIFs are targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxia, attenuated hydroxylation allows HIFs to escape degradation, translocate to the nucleus, heterodimerize with HIF1B, and upregulate hypoxia-inducible genes. As the most critical isozyme under normoxia, EGLN1 regulates HIF1 stability and participates in hypoxia-influenced processes like angiogenesis in retinal and cardiac functions. Target proteins are preferentially recognized through a LXXLAP motif.

Biological Activity

In the presence of α-ketoglutarate, PHD2 can bind to the F-P564 peptide; the F-P564 peptide is a fluorescently labeled polypeptide (mimicking the proline site sequence of HIF-1α). In the experiment, the binding efficiency was detected by fluorescence polarization assay, and the change in fluorescence signal can indirectly reflect the activity of PHD2.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9GZT9-1 (P181-F426)

Gene ID

54583

Protein Length

Partial

Synonyms
C1orf12; PNAS-118; PNAS-137; Egl nine homolog 1; Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2; HIF-prolyl hydroxylase 2; HPH-2); Prolyl hydroxylase domain-containing protein 2 (PHD2)
AA Sequence

PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF

Predicted Molecular Mass
28.4 kDa
Molecular Weight

28.4 KDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of PBS.
2.Supplied as a 0.22 μm filtered solution of 25 mM Tris-HCl, pH 7.5, 150 mM NaCl.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

EGLN1 Protein, Human (246a.a, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EGLN1 Protein, Human (246a.a, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGLN1 Protein, Human (246a.a, His)
Cat. No.:
HY-P703327
Quantity:
MCE Japan Authorized Agent: