EIF4E1 Protein, Human

Customer Review

Based on 1 Customer Validation

EIF4E1 Protein, Human is the recombinant human-derived EIF4E1, expressed by E. coli , with tag Free labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

EIF4E1 Protein, Human is the recombinant human-derived EIF4E1, expressed by E. coli , with tag Free labeled tag.

Background

EIF4E1 is a component of the protein complex eIF4F, which is involved in recognizing the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structures, and recruiting mRNA to the ribosome. It recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step of protein synthesis and facilitates ribosome binding by inducing the unwinding of mRNA secondary structures (By similarity). Additionally, EIF4E1 is a key component of recessive resistance to potyviruses.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    EIF4E; EIF-4F 25 KDa Subunit; Prev. EIF4EL1; Eukaryotic Translation Initiation Factor 4E-Like 1; Prev. EIF4F; AUTS19; EIF4E1; CBP; MRNA Cap-Binding Protein; Eukaryotic Translation Initiation Factor 4E; EIF-4E

  • AA Sequence

    SHPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKWTMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIHEDAKKLDRNAKNAYTA

  • Predicted Molecular Mass

    20.5 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200mM NaCl, 20% glycerol, 1mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00