EIF4E1 Protein, Human
Based on 1 Customer Validation
EIF4E1 Protein, Human is the recombinant human-derived EIF4E1, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
EIF4E1 Protein, Human is the recombinant human-derived EIF4E1, expressed by E. coli , with tag Free labeled tag.
EIF4E1 is a component of the protein complex eIF4F, which is involved in recognizing the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structures, and recruiting mRNA to the ribosome. It recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step of protein synthesis and facilitates ribosome binding by inducing the unwinding of mRNA secondary structures (By similarity). Additionally, EIF4E1 is a key component of recessive resistance to potyviruses.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O23252 (S59-A235)
-
Gene ID827529
-
Protein Length
Partial
-
Synonyms
CUM1
-
AA Sequence
SHPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKWTMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIHEDAKKLDRNAKNAYTA
-
Predicted Molecular Mass
20.5 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200mM NaCl, 20% glycerol, 1mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
