EIF5A2 Protein, Human (His)
EIF5A2 is a translation factor critical for promoting elongation and termination, helping stalled ribosomes encounter specific amino acid environments. EIF5A2 is located between the ribosome exit (E) and peptidyl (P) sites and rescues stalled ribosomes, especially those translating polyproline-containing peptides. EIF5A2 Protein, Human (His) is the recombinant human-derived EIF5A2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
EIF5A2 is a translation factor critical for promoting elongation and termination, helping stalled ribosomes encounter specific amino acid environments. EIF5A2 is located between the ribosome exit (E) and peptidyl (P) sites and rescues stalled ribosomes, especially those translating polyproline-containing peptides. EIF5A2 Protein, Human (His) is the recombinant human-derived EIF5A2 protein, expressed by E. coli , with N-6*His labeled tag.
EIF5A2, a translation factor, plays a pivotal role in promoting translation elongation and termination, especially when ribosomes encounter specific amino acid sequence contexts leading to stalling. Positioned between the exit (E) and peptidyl (P) sites of the ribosome, EIF5A2 facilitates the rescue of stalled ribosomes, particularly those translating polyproline-containing peptides and other motifs causing ribosomal stalling. Additionally, EIF5A2 serves as a cofactor in ribosome quality control (RQC), aiding the RQC complex in the peptidyl transfer during the CAT tailing step. Beyond its role in translation, EIF5A2 is implicated in actin dynamics, cell cycle progression, mRNA decay, and likely participates in stress response and cell wall integrity maintenance. It exhibits mutually exclusive binding with EEF2/eEF2 on actively translating ribosomes. Notably, EIF5A2 interacts with DAPL1, forming a complex at the polypeptide exit tunnel of hibernating ribosomes, thereby preventing translation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9GZV4 (M1-K153)
-
Molecular Construction
-
N-term
-
6*His
-
EIF5A2 (M1-K153)
Accession # Q9GZV4 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EIF5A2; Eukaryotic Initiation Factor 5A Isoform 2; Eukaryotic Translation Initiation Factor 5A2; Eukaryotic Initiation Factor 5A; Eukaryotic Translation Initiation Factor 5A-2; Alternative Protein EIF5A2; EIF-5A-2; EIF5AII; EIF-5A2; EIF-5A; Eukaryotic Tra
-
AA Sequence
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
-
Predicted Molecular Mass
18.9 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
