ENPP-3 Protein, Human (110a.a, HEK293, His-Avi)
ENPP3 is a hydrolase that metabolizes extracellular nucleotides, including ATP, GTP, UTP, and CTP, and plays a key role in immune regulation. It modulates mast cell and basophil responses during inflammation and chronic allergic phases by eliminating extracellular ATP, a trigger for inflammatory cytokine release. ENPP-3 Protein, Human (110a.a, HEK293, His-Avi) is the recombinant human-derived ENPP-3 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ENPP3 is a hydrolase that metabolizes extracellular nucleotides, including ATP, GTP, UTP, and CTP, and plays a key role in immune regulation. It modulates mast cell and basophil responses during inflammation and chronic allergic phases by eliminating extracellular ATP, a trigger for inflammatory cytokine release. ENPP-3 Protein, Human (110a.a, HEK293, His-Avi) is the recombinant human-derived ENPP-3 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.
Background
ENPP3, a hydrolase, plays a pivotal role in metabolizing extracellular nucleotides, encompassing ATP, GTP, UTP, and CTP. This enzymatic activity is instrumental in modulating immune responses, particularly in the regulation of mast cell and basophil reactions during inflammation and chronic allergic phases. ENPP3 achieves this by eliminating extracellular ATP, a signaling molecule that activates basophils and mast cells, subsequently triggering the release of inflammatory cytokines. Furthermore, within the small intestine's lumen, ENPP3 metabolizes extracellular ATP, effectively preventing ATP-induced apoptosis in intestinal plasmacytoid dendritic cells. Alongside its involvement in nucleotide metabolism, ENPP3 exhibits alkaline phosphodiesterase activity, adding to its diverse functions in cellular processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Avi;N-8*His
-
Accession
O14638 (L48-D157)
-
Molecular Construction
-
N-term
-
8*His-Avi
-
ENPP-3 (L48-D157)
Accession # O14638 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
ENPP3; B10; Prev. PDNP3; NPPase; Ectonucleotide Pyrophosphatase/Phosphodiesterase Family Member 3; NPP3; Phosphodiesterase I/Nucleotide Pyrophosphatase 3; DJ334I18.1 (Ectonucleotide Pyrophosphatase/Phosphodiesterase 3); Alkaline Phosphodiesterase I; DJ100
-
AA Sequence
LEKQGSCRKKCFDASFRGLENCRCDVACKDRGDCCWDFEDTCVESTRIWMCNKFRCGETRLEASLCSCSDDCLQRKDCCADYKSVCQGETSWLEENCDTAQQSQCPEGFD
-
Predicted Molecular Mass
17.2 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
