ENPP-3 Protein, Human (110a.a, HEK293, His-Avi)

ENPP3 is a hydrolase that metabolizes extracellular nucleotides, including ATP, GTP, UTP, and CTP, and plays a key role in immune regulation. It modulates mast cell and basophil responses during inflammation and chronic allergic phases by eliminating extracellular ATP, a trigger for inflammatory cytokine release. ENPP-3 Protein, Human (110a.a, HEK293, His-Avi) is the recombinant human-derived ENPP-3 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

ENPP3, a hydrolase, plays a pivotal role in metabolizing extracellular nucleotides, encompassing ATP, GTP, UTP, and CTP. This enzymatic activity is instrumental in modulating immune responses, particularly in the regulation of mast cell and basophil reactions during inflammation and chronic allergic phases. ENPP3 achieves this by eliminating extracellular ATP, a signaling molecule that activates basophils and mast cells, subsequently triggering the release of inflammatory cytokines. Furthermore, within the small intestine's lumen, ENPP3 metabolizes extracellular ATP, effectively preventing ATP-induced apoptosis in intestinal plasmacytoid dendritic cells. Alongside its involvement in nucleotide metabolism, ENPP3 exhibits alkaline phosphodiesterase activity, adding to its diverse functions in cellular processes.

Human

HEK293

N-Avi;N-8*His

O14638 (L48-D157)

5169  [NCBI]

Partial

LEKQGSCRKKCFDASFRGLENCRCDVACKDRGDCCWDFEDTCVESTRIWMCNKFRCGETRLEASLCSCSDDCLQRKDCCADYKSVCQGETSWLEENCDTAQQSQCPEGFD

Approximately 18-20 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.