1. Recombinant Proteins
  2. Enzymes & Regulators Biotinylated Proteins
  3. Hydrolases (EC 3) Phosphatase
  4. ENPP-3
  5. ENPP-3 Protein, Human (Biotinylated, 110a.a, HEK293, His-Avi)

ENPP-3 Protein, Human (Biotinylated, 110a.a, HEK293, His-Avi)

Cat. No.: HY-P77927
Handling Instructions Technical Support

ENPP3 is a hydrolase that metabolizes extracellular nucleotides, including ATP, GTP, UTP, and CTP, and plays a key role in immune regulation. It modulates mast cell and basophil responses during inflammation and chronic allergic phases by eliminating extracellular ATP, a trigger for inflammatory cytokine release. ENPP-3 Protein, Human (Biotinylated, 110a.a, HEK293, His-Avi) is the recombinant human-derived ENPP-3 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

ENPP3 is a hydrolase that metabolizes extracellular nucleotides, including ATP, GTP, UTP, and CTP, and plays a key role in immune regulation. It modulates mast cell and basophil responses during inflammation and chronic allergic phases by eliminating extracellular ATP, a trigger for inflammatory cytokine release. ENPP-3 Protein, Human (Biotinylated, 110a.a, HEK293, His-Avi) is the recombinant human-derived ENPP-3 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Background

ENPP3, a hydrolase, plays a pivotal role in metabolizing extracellular nucleotides, encompassing ATP, GTP, UTP, and CTP. This enzymatic activity is instrumental in modulating immune responses, particularly in the regulation of mast cell and basophil reactions during inflammation and chronic allergic phases. ENPP3 achieves this by eliminating extracellular ATP, a signaling molecule that activates basophils and mast cells, subsequently triggering the release of inflammatory cytokines. Furthermore, within the small intestine's lumen, ENPP3 metabolizes extracellular ATP, effectively preventing ATP-induced apoptosis in intestinal plasmacytoid dendritic cells. Alongside its involvement in nucleotide metabolism, ENPP3 exhibits alkaline phosphodiesterase activity, adding to its diverse functions in cellular processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

N-Avi;N-8*His

Accession

O14638 (L48-D157)

Gene ID
Molecular Construction
N-term
8*His-Avi
ENPP-3 (L48-D157)
Accession # O14638
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
E-NPP 3; NPP3; PD-Ibeta; NPPase; ENPP3; PDNP3; CD203c; B10; gp130RB13-6
AA Sequence

LEKQGSCRKKCFDASFRGLENCRCDVACKDRGDCCWDFEDTCVESTRIWMCNKFRCGETRLEASLCSCSDDCLQRKDCCADYKSVCQGETSWLEENCDTAQQSQCPEGFD

Predicted Molecular Mass
17.2 kDa
분자량

Approximately 18-20 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

ENPP-3 Protein, Human (Biotinylated, 110a.a, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

ENPP-3 Protein, Human (Biotinylated, 110a.a, HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
ENPP-3 Protein, Human (Biotinylated, 110a.a, HEK293, His-Avi)
Cat. No.:
HY-P77927
수량:
MCE Japan Authorized Agent: