Enterotoxin type A Protein, S. aureus (sf9, His-Myc)
Enterotoxins (ETAs) trigger host immune system activation by binding to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction triggers a cascade of cell activation, cytokine production and migration, primarily mediated by Alphata T cells, affecting lung tissue and airways. Enterotoxin type A Protein, S. aureus (sf9, His-Myc) is the recombinant Staphylococcus aureus-derived Enterotoxin type A protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag.
- Species: Staphylococcus aureus
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Enterotoxins (ETAs) trigger host immune system activation by binding to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction triggers a cascade of cell activation, cytokine production and migration, primarily mediated by Alphata T cells, affecting lung tissue and airways. Enterotoxin type A Protein, S. aureus (sf9, His-Myc) is the recombinant Staphylococcus aureus-derived Enterotoxin type A protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag.
Background
Enterotoxin type A (ETA) is a staphylococcal enterotoxin that instigates host immune system activation by binding in its unprocessed form to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction sets off a cascade of events involving waves of cellular activation, cytokine production, and migration, primarily mediated by alphabeta T-cells, ultimately affecting lung tissue and airways. Additionally, ETA is implicated in the development of staphylococcal food poisoning syndrome, characterized by symptoms such as high fever, hypotension, diarrhea, shock, and, in severe cases, potential fatality.
Technical Parameters
-
Species Staphylococcus aureus
-
Source Sf9 insect cells
-
Tag N-10*His;C-Myc
-
Accession
P0A0L2 (S25-S257)
-
Gene ID/
-
Molecular Construction
-
N-term
-
10*His
-
SEA (S25-S257)
Accession # P0A0L2 -
Myc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Enterotoxin type A; SEA; entA
-
AA Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
-
Predicted Molecular Mass
31 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)