Enterotoxin type A Protein, S. aureus (sf9, His-Myc)

Enterotoxins (ETAs) trigger host immune system activation by binding to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction triggers a cascade of cell activation, cytokine production and migration, primarily mediated by Alphata T cells, affecting lung tissue and airways. Enterotoxin type A Protein, S. aureus (sf9, His-Myc) is the recombinant Staphylococcus aureus-derived Enterotoxin type A protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Staphylococcus aureus
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Enterotoxins (ETAs) trigger host immune system activation by binding to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction triggers a cascade of cell activation, cytokine production and migration, primarily mediated by Alphata T cells, affecting lung tissue and airways. Enterotoxin type A Protein, S. aureus (sf9, His-Myc) is the recombinant Staphylococcus aureus-derived Enterotoxin type A protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag.

Background

Enterotoxin type A (ETA) is a staphylococcal enterotoxin that instigates host immune system activation by binding in its unprocessed form to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction sets off a cascade of events involving waves of cellular activation, cytokine production, and migration, primarily mediated by alphabeta T-cells, ultimately affecting lung tissue and airways. Additionally, ETA is implicated in the development of staphylococcal food poisoning syndrome, characterized by symptoms such as high fever, hypotension, diarrhea, shock, and, in severe cases, potential fatality.

Technical Parameters

  • Species Staphylococcus aureus
  • Source Sf9 insect cells
  • Tag N-10*His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • SEA (S25-S257)
      Accession # P0A0L2
    • Myc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Enterotoxin type A; SEA; entA

  • AA Sequence

    SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS

  • Predicted Molecular Mass

    31 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00