EphA3 Protein, Human (Active, sf9, GST)
Based on 1 Customer Validation
The EphA3 protein is a receptor tyrosine kinase that promiscuously binds to membrane-bound ephrin ligands to initiate bidirectional signaling. Activation of EphA3 is known to preferentially bind to EFNA5 and regulates cell-cell adhesion, cytoskeletal organization, and migration. EphA3 Protein, Human (sf9, GST) is the recombinant human-derived EphA3, expressed by Sf9 insect cells, with GST labeled tag. The total length of EphA3 Protein, Human (sf9, GST) is 405 a.a..
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The EphA3 protein is a receptor tyrosine kinase that promiscuously binds to membrane-bound ephrin ligands to initiate bidirectional signaling. Activation of EphA3 is known to preferentially bind to EFNA5 and regulates cell-cell adhesion, cytoskeletal organization, and migration. EphA3 Protein, Human (sf9, GST) is the recombinant human-derived EphA3, expressed by Sf9 insect cells, with GST labeled tag. The total length of EphA3 Protein, Human (sf9, GST) is 405 a.a..
Background
The EphA3 protein, a receptor tyrosine kinase, engages in promiscuous binding to membrane-bound ephrin family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is known as forward signaling, while the pathway downstream of the ephrin ligand is termed reverse signaling. Highly promiscuous for ephrin-A ligands, EphA3 exhibits a preferential binding affinity for EFNA5. Upon activation by EFNA5, EphA3 plays a pivotal role in regulating cell-cell adhesion, cytoskeletal organization, and cell migration. Additionally, EphA3 is implicated in cardiac cell migration and differentiation, regulating the formation of the atrioventricular canal and septum during development, likely through activation by EFNA1. In the context of retinotectal mapping, EphA3 is involved in the guidance of neurons. Furthermore, EphA3 may control the segregation, though not the guidance, of motor and sensory axons during neuromuscular circuit development.
Verified Bioactivity
The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 5 nM, the conversion rate is about 20%.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
P29320-1 (K579-V983)
-
Gene ID2042
-
Protein Length
Partial
-
Synonyms
EPHA3; Tyrosine-Protein Kinase TYRO4; Prev. TYRO4; EK4; Prev. ETK1; Receptor Protein-Tyrosine Kinase; Prev. ETK; Ephrin Type-A Receptor 3 Variant; HEK4; Testicular Tissue Protein Li 64; HEK; TYRO4 Protein Tyrosine Kinase; Ephrin Type-A Receptor 3; Human E
-
AA Sequence
KRLHFGNGHLKLPGLRTYVDPHTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKIISSIKALETQSKNGPVPV
-
Predicted Molecular Mass
71.9 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 20% glycerol, 5 mM DTT, 0.1 M trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
