Copy Link Print Information

FABP2/I-FABP Protein, Human (His)

Customer Review

Based on 1 Customer Validation

FABP2, also known as I-FABP, is involved in the intracellular transport of long-chain fatty acids and their acyl-CoA esters, reflecting its potential role in various metabolic processes. In particular, FABP2 is thought to be involved in triglyceride-rich lipoprotein synthesis, suggesting its importance in lipid metabolism. FABP2/I-FABP Protein, Human (His) is the recombinant human-derived FABP2/I-FABP protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • FABP2/I-FABP Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FABP2, also known as I-FABP, is involved in the intracellular transport of long-chain fatty acids and their acyl-CoA esters, reflecting its potential role in various metabolic processes. In particular, FABP2 is thought to be involved in triglyceride-rich lipoprotein synthesis, suggesting its importance in lipid metabolism. FABP2/I-FABP Protein, Human (His) is the recombinant human-derived FABP2/I-FABP protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Background

The FABP2, also known as I-FABP (intestinal fatty acid-binding protein), is a member of the fatty acid-binding protein (FABP) family and is implicated in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 likely plays a role in triglyceride-rich lipoprotein synthesis. Notably, FABP2 exhibits a high affinity for saturated long-chain fatty acids, but its binding affinity is lower for unsaturated long-chain fatty acids. Additionally, FABP2 may contribute to the maintenance of energy homeostasis by functioning as a lipid sensor. These characteristics highlight the multifaceted role of FABP2 in cellular lipid metabolism, where it participates in fatty acid transport, influences lipoprotein synthesis, and potentially acts as a sensor to help regulate energy balance within cells.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;C-6*His
  • Accession

    AAH69466.1 (M1-D132)

  • Gene ID
    2169  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • FABP2 (M1-D132)
      Accession # AAH69466.1
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FABP2; Fatty Acid Binding Protein 2, Intestinal; Fatty Acid Binding Protein 2; Fatty Acid-Binding Protein, Intestinal; I-FABP; FABPI; Intestinal-Type Fatty Acid-Binding Protein; Fatty Acid-Binding Protein 2

  • AA Sequence

    MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

  • Predicted Molecular Mass

    18.4 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 50 mM NaCl, 8% Trehalose, 0.05% Tween 80, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • FABP2/I-FABP Protein, Human (His) Product Image
    1/16
  • FABP2/I-FABP Protein, Human (His) Product Image