Fc gamma RIIB/CD32b Protein, Human (Biotinylated, HEK293, His-Avi)

Fc gamma RIIB/CD32b protein is a low-affinity receptor for immunoglobulin gamma and plays a key role in immune responses. It mediates phagocytosis of immune complexes and regulates antibody production by B cells. Fc gamma RIIB/CD32b Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Fc gamma RIIB/CD32b Protein serves as a receptor for the Fc region of complexed or aggregated immunoglobulins gamma, displaying low affinity. It plays a pivotal role in various effector and regulatory functions, including the phagocytosis of immune complexes and the modulation of antibody production by B-cells. Upon binding to this receptor, there is a down-modulation of the preceding state of cell activation triggered through antigen receptors on B-cells (BCR), T-cells (TCR), or another Fc receptor. Notably, isoform IIB1 is unable to mediate endocytosis or phagocytosis, while isoform IIB2 does not induce phagocytosis. Fc gamma RIIB/CD32b interacts with INPP5D/SHIP1, FGR, and LYN.

Loaded Biotinylated Human FcγRIIB/C / CD32b/c protein (His & Avi Tag) on SA Biosensor, can bind Bevacizumab (IgG1) with an affinity constant of 1.2 μM as determined in a BLI assay.

Human

HEK293

C-Avi;C-His

P31994-2/NP_001002274.1 (A46-I224)

2213  [NCBI]

Partial

Biotin

APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGI

Approximately 35 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.