1. Recombinant Proteins
  2. CD Antigens Fc Receptors Biotinylated Proteins
  3. Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins Fc-gamma Receptor
  4. Fc gamma RII/CD32
  5. FcγRIIB/CD32b
  6. Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi)

Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P75649
Handling Instructions Technical Support

Fc gamma RIIB/CD32b protein is essential for IgG binding activity and participates in immune responses and various processes. It plays a role in antigen processing and presentation, negative regulation of immune processes, and phagocytosis. Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc gamma RIIB/CD32b protein is essential for IgG binding activity and participates in immune responses and various processes. It plays a role in antigen processing and presentation, negative regulation of immune processes, and phagocytosis. Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

Fc gamma RIIB/CD32b Protein plays a crucial role by enabling IgG binding activity, indicating its involvement in immune responses. Engaged in diverse processes such as cellular response to amyloid-beta, nervous system development, and regulation of cellular response to stress, the protein acts upstream of or within processes including antigen processing and presentation of exogenous peptide antigen via MHC class II, negative regulation of immune effector processes, and regulation of phagocytosis. It is strategically located in the cell body, dendritic spine, and the external side of the plasma membrane, functioning as an integral component of the membrane. Broadly expressed in tissues such as the kidney (RPKM 19.1), spleen (RPKM 16.7), and 21 other tissues, Fc gamma RIIB/CD32b demonstrates its significance in immune regulation across various physiological contexts. The human ortholog(s) of this gene have been implicated in several diseases, including autoimmune diseases, dengue disease, hematologic cancers, leukopenia, and malaria, underscoring its critical role in health and disease.

Biological Activity

1.Loaded Recombinant Mouse CD32B/Fcgr2b Protein, His Tag, Biotinylated on SA Biosensor, can bind Monoclonal Anti-Human CD3 Antibody, Mouse IgG2a (OKT3) with an affinity constant of 1.0-5.0 µM as determined in BLI assay.
2.Recombinant Mouse CD32 / FCGR2B Protein (His & AVI Tag), Biotinylated immobilized on SA chip, can bind Anti-CD3 (Research Grade OKT3 Biosimilar) with an affinity constant of 6.0-10.0 μM as determined in an SPR assay.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-His

Accession

P08101-1 (T30-R207)

Gene ID
Molecular Construction
N-term
CD32b (T30-R207)
Accession # P08101-1
Avi-His
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-b; IgG Fc Receptor II-b; CDw32; FcRII-b; CD32; FCGR2B; FCG2; IGFR2
AA Sequence

THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR

Predicted Molecular Mass
23.9 kDa
Molecular Weight

Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P75649
Quantity:
MCE Japan Authorized Agent: