Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

Fc gamma RIIB/CD32b protein is essential for IgG binding activity and participates in immune responses and various processes. It plays a role in antigen processing and presentation, negative regulation of immune processes, and phagocytosis. Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Fc gamma RIIB/CD32b protein is essential for IgG binding activity and participates in immune responses and various processes. It plays a role in antigen processing and presentation, negative regulation of immune processes, and phagocytosis. Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

Fc gamma RIIB/CD32b Protein plays a crucial role by enabling IgG binding activity, indicating its involvement in immune responses. Engaged in diverse processes such as cellular response to amyloid-beta, nervous system development, and regulation of cellular response to stress, the protein acts upstream of or within processes including antigen processing and presentation of exogenous peptide antigen via MHC class II, negative regulation of immune effector processes, and regulation of phagocytosis. It is strategically located in the cell body, dendritic spine, and the external side of the plasma membrane, functioning as an integral component of the membrane. Broadly expressed in tissues such as the kidney (RPKM 19.1), spleen (RPKM 16.7), and 21 other tissues, Fc gamma RIIB/CD32b demonstrates its significance in immune regulation across various physiological contexts. The human ortholog(s) of this gene have been implicated in several diseases, including autoimmune diseases, dengue disease, hematologic cancers, leukopenia, and malaria, underscoring its critical role in health and disease.

Verified Bioactivity

1.Loaded Recombinant Mouse CD32B/Fcgr2b Protein, His Tag, Biotinylated on SA Biosensor, can bind Monoclonal Anti-Human CD3 Antibody, Mouse IgG2a (OKT3) with an affinity constant of 1.0-5.0 µM as determined in BLI assay.
2.Recombinant Mouse CD32 / FCGR2B Protein (His & AVI Tag), Biotinylated immobilized on SA chip, can bind Anti-CD3 (Research Grade OKT3 Biosimilar) with an affinity constant of 6.0-10.0 μM as determined in an SPR assay.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD32b (T30-R207)
      Accession # P08101-1
    • Avi-His
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    FCGR2B; Fc-Gamma-RIIb; Prev. FCG2; FcGRIIB; Prev. FCGR2; FcRII-B; CD32; IGFR2; CD32B; CDw32; Fc Fragment Of IgG, Low Affinity IIb, Receptor For (CD32); Fc Fragment Of IgG, Low Affinity II, Receptor For (CD32); Low Affinity Immunoglobulin Gamma Fc Region R

  • AA Sequence

    THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR

  • Predicted Molecular Mass

    23.9 kDa

  • Molecular Weight

    Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00