Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
Fc gamma RIIB/CD32b protein is essential for IgG binding activity and participates in immune responses and various processes. It plays a role in antigen processing and presentation, negative regulation of immune processes, and phagocytosis. Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Fc gamma RIIB/CD32b protein is essential for IgG binding activity and participates in immune responses and various processes. It plays a role in antigen processing and presentation, negative regulation of immune processes, and phagocytosis. Fc gamma RIIB/CD32b Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
Fc gamma RIIB/CD32b Protein plays a crucial role by enabling IgG binding activity, indicating its involvement in immune responses. Engaged in diverse processes such as cellular response to amyloid-beta, nervous system development, and regulation of cellular response to stress, the protein acts upstream of or within processes including antigen processing and presentation of exogenous peptide antigen via MHC class II, negative regulation of immune effector processes, and regulation of phagocytosis. It is strategically located in the cell body, dendritic spine, and the external side of the plasma membrane, functioning as an integral component of the membrane. Broadly expressed in tissues such as the kidney (RPKM 19.1), spleen (RPKM 16.7), and 21 other tissues, Fc gamma RIIB/CD32b demonstrates its significance in immune regulation across various physiological contexts. The human ortholog(s) of this gene have been implicated in several diseases, including autoimmune diseases, dengue disease, hematologic cancers, leukopenia, and malaria, underscoring its critical role in health and disease.
Verified Bioactivity
1.Loaded Recombinant Mouse CD32B/Fcgr2b Protein, His Tag, Biotinylated on SA Biosensor, can bind Monoclonal Anti-Human CD3 Antibody, Mouse IgG2a (OKT3) with an affinity constant of 1.0-5.0 µM as determined in BLI assay.
2.Recombinant Mouse CD32 / FCGR2B Protein (His & AVI Tag), Biotinylated immobilized on SA chip, can bind Anti-CD3 (Research Grade OKT3 Biosimilar) with an affinity constant of 6.0-10.0 μM as determined in an SPR assay.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P08101-1 (T30-R207)
-
Molecular Construction
-
N-term
-
CD32b (T30-R207)
Accession # P08101-1 -
Avi-His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
FCGR2B; Fc-Gamma-RIIb; Prev. FCG2; FcGRIIB; Prev. FCGR2; FcRII-B; CD32; IGFR2; CD32B; CDw32; Fc Fragment Of IgG, Low Affinity IIb, Receptor For (CD32); Fc Fragment Of IgG, Low Affinity II, Receptor For (CD32); Low Affinity Immunoglobulin Gamma Fc Region R
-
AA Sequence
THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR
-
Predicted Molecular Mass
23.9 kDa
-
Molecular Weight
Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
