Copy Link Print Information

Fc gamma RIIB/CD32b Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

Fc gamma RIIB/CD32b Protein plays a crucial role, specifically binding to the Fc region of immunoglobulins gamma as a low-affinity receptor. Binding to IgG, it initiates cellular responses against pathogens, highlighting its immune system modulation. Interactions with FGR and LYN underscore its role in signaling pathways, emphasizing its significance in mediating cellular responses and contributing to immune defense against diverse antigens. Fc gamma RIIB/CD32b Protein, Rat (HEK293, His) is the recombinant rat-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Fc gamma RIIB/CD32b Protein, Rat (HEK293, His)
  • Experimental Validation Results for Fc gamma RIIB/CD32b Protein, Rat (HEK293, His)
  • Fc gamma RIIB/CD32b Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Fc gamma RIIB/CD32b Protein plays a crucial role, specifically binding to the Fc region of immunoglobulins gamma as a low-affinity receptor. Binding to IgG, it initiates cellular responses against pathogens, highlighting its immune system modulation. Interactions with FGR and LYN underscore its role in signaling pathways, emphasizing its significance in mediating cellular responses and contributing to immune defense against diverse antigens. Fc gamma RIIB/CD32b Protein, Rat (HEK293, His) is the recombinant rat-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-His labeled tag.

Background

The Fc gamma RIIB/CD32b protein assumes a crucial role as it specifically binds to the Fc region of immunoglobulins gamma, functioning as a low-affinity receptor. Through its binding to IgG, Fc gamma RIIB/CD32b initiates cellular responses against pathogens and soluble antigens, highlighting its involvement in immune system modulation. The protein's interactions with FGR and LYN further emphasize its role in intricate signaling pathways, underlining its significance in mediating cellular responses and contributing to immune defense mechanisms against diverse antigens.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rat CD32b, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 0.3838 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Rat CD32b, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 0.3838 μg/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    Q63203 (H32-P212)

  • Gene ID
    289211  [NCBI]
  • Molecular Construction
    • N-term
    • CD32b (H32-P212)
      Accession # Q63203
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    FCGR2B; Fc-Gamma-RIIb; Prev. FCG2; FcGRIIB; Prev. FCGR2; FcRII-B; CD32; IGFR2; CD32B; CDw32; Fc Fragment Of IgG, Low Affinity IIb, Receptor For (CD32); Fc Fragment Of IgG, Low Affinity II, Receptor For (CD32); Low Affinity Immunoglobulin Gamma Fc Region R

  • AA Sequence

    HAGLPKAVVKLEPPWIQVLKEDTVTLMCEGTHNTKNCSTQWFHNGSSIWHQAQANYTFKATVNDSGEYRCRMEETGISEPIHLGVISDWLLLQTSQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYHQSSNFSIPKANHSHSGNYYCKAYLGRTMHVSKPVTITVQEPKSSSSLP

  • Molecular Weight

    Approximately 33-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Rat CD32b, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 0.3838 μg/mL.

  • Fc gamma RIIB/CD32b Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Fc gamma RIIB/CD32b Protein, Rat (HEK293, His)
  • Experimental Validation Results for Fc gamma RIIB/CD32b Protein, Rat (HEK293, His)
  • Fc gamma RIIB/CD32b Protein, Rat (HEK293, His) Product Image