FCGRT Protein, Human (HEK293, His)
The FCGRT protein is a cell surface receptor that conveys passive humoral immunity through the selective uptake of monomeric IgG in milk. It binds IgG at the intestinal epithelium and forms an FcRn-IgG complex that is transcytosed across the epithelium, releasing IgG into the blood or tissue. FCGRT Protein, Human (HEK293, His) is the recombinant human-derived FCGRT protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The FCGRT protein is a cell surface receptor that conveys passive humoral immunity through the selective uptake of monomeric IgG in milk. It binds IgG at the intestinal epithelium and forms an FcRn-IgG complex that is transcytosed across the epithelium, releasing IgG into the blood or tissue. FCGRT Protein, Human (HEK293, His) is the recombinant human-derived FCGRT protein, expressed by HEK293 , with N-His labeled tag.
Background
FCGRT, a crucial cell surface receptor, facilitates the transfer of passive humoral immunity from the mother to the newborn by binding to the Fc region of monomeric immunoglobulin gamma and selectively mediating its uptake from milk. The process involves IgG binding at the apical surface of the intestinal epithelium, forming FcRn-IgG complexes that transcytose across the intestinal epithelium, releasing IgG into blood or tissue fluids. Beyond infancy, FCGRT plays a pivotal role in effective humoral immunity by recycling IgG and prolonging its half-life in the circulation. Mechanistically, the binding of monomeric IgG to FCGRT in acidic endosomes of endothelial and hematopoietic cells facilitates the recycling of IgG to the cell surface, subsequently releasing it into circulation. Additionally, FCGRT regulates the homeostasis of albumin/ALB, the other most abundant circulating protein, further underscoring its essential role in immune and protein homeostasis. In the context of microbial infection, FCGRT acts as an uncoating receptor for various echoviruses, including Echovirus 5, 6, 7, 9, 11, 13, 25, and 29.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
P55899 (A24-S297)
-
Molecular Construction
-
N-term
-
His
-
FCGRT (A24-S297)
Accession # P55899 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FCGRT; Major Histocompatibility Complex Class I-Like Fc Receptor; Fc Gamma Receptor And Transporter; Neonatal Crystallizable Fc Receptor FcRn Splice Variant 6; Neonatal Fc Receptor; Neonatal Crystallizable Fc Receptor FcRn Splice Variant 5; FcRn; Neonatal
-
AA Sequence
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
-
Predicted Molecular Mass
34.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)