FGF-1 Protein, Rat
FGF-1 Protein, Rat is the recombinant rat-derived FGF-1 protein, expressed by E. coli, with tag free tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
FGF-1 Protein, Rat is the recombinant rat-derived FGF-1 protein, expressed by E. coli, with tag free tag.
The FGF-1 protein plays a pivotal role in regulating important cellular processes such as cell survival, division, angiogenesis, differentiation, and migration. In vitro, it exhibits potent mitogenic properties and acts as a ligand for both FGFR1 and integrins. When heparin is present, FGF-1 binds to FGFR1, resulting in the dimerization and activation of FGFR1 through autophosphorylation on tyrosine residues. These phosphorylated residues serve as docking sites for interacting proteins, initiating various signaling cascades. FGF-1 also binds to integrins and forms a ternary complex with integrins and FGFR1, which is crucial for FGF-1 signaling.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
P61149 (F16-D155)
-
Gene ID25317
-
Molecular Construction
-
N-term
-
FGF-1 (F16-D155)
Accession # P61149 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FGF1; Endothelial Cell Growth Factor, Alpha; Prev. FGFA; Fibroblast Growth Factor 1 (Acidic); Heparin-Binding Growth Factor 1; Acidic Fibroblast Growth Factor; AFGF; HBGF-1; ECGF; FGF-1; ECGF-Beta; Beta-Endothelial Cell Growth Factor; FGF-Alpha; Endotheli
-
AA Sequence
FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.;≥ 95%, as determined by HPLC.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)