FGF-basic Protein, Salmon

For research use only. We do not sell to patients.

* Please select Quantity before adding items.

Species	Others
Source	E. coli
Tag	Tag Free
Accession	XP_035600424.1 (M1-R155)
Gene ID	118363560
Molecular Construction	N-term FGF-basic (M1-R155) Accession # XP_035600424.1 C-term
Synonyms	Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2; FGF2; FGFB
AA Sequence	MATGEITTLPATPEDGGSGGFPPGNFKEPKRLYCKNGGYFLRINSNGSVDGIREKNDPHIKLQLQATSVGEVVIKGVSANRYLAMNGDGRLFGTRRTTDECYFMERLESNNYNTYRSRKYPDMYVALKRTGQHKSGSKTGPGQKAILFLPMSARR
Molecular Weight	Approximately 20 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level	< 0.2 EU/μg of protein by gel clotting method
Documentation	Data Sheet (232 KB) Handling Instructions (2659 KB)

FGF-basic Protein, Salmon Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.