FGF basic Protein, Salmon
Based on 1 Customer Validation
FGF basic Protein, Salmon is the recombinant FGF-basic protein, expressed by E. coli, with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF basic Protein, Salmon is the recombinant FGF-basic protein, expressed by E. coli, with tag free.
Verified Bioactivity
Measure by its ability by a dose-response proliferation assay using murine Balb/c 3T3 cells. The ED50 for this effect is <1 ng/mL. The specific activity of this protein is > 1.0 × 106 IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
XP_035600424.1 (M1-R155)
-
Gene ID118363560
-
Molecular Construction
-
N-term
-
FGF basic (M1-R155)
Accession # XP_035600424.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FGF2; BFGF; Prev. FGFB; Basic Fibroblast Growth Factor; Fibroblast Growth Factor 2 (Basic); Fibroblast Growth Factor; Heparin-Binding Growth Factor 2; Prostatropin; HBGF-2; FGF2A; FGF-2; FGF; Fibroblast Growth Factor 2; Basic Fibroblast Growth Factor BFGF
-
AA Sequence
MATGEITTLPATPEDGGSGGFPPGNFKEPKRLYCKNGGYFLRINSNGSVDGIREKNDPHIKLQLQATSVGEVVIKGVSANRYLAMNGDGRLFGTRRTTDECYFMERLESNNYNTYRSRKYPDMYVALKRTGQHKSGSKTGPGQKAILFLPMSARR
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under non reducing (N) conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 7.8 mM Na2HPO4, 1.5 mM KH2PO4, 2.7 mM KCl, 500 mM NaCl.
< 0.2 EU/μg of protein by gel clotting method
It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)