FGFR-3 alpha (IIIc) Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The FGFR-3 protein is a tyrosine protein kinase that serves as a cell surface receptor for fibroblast growth factors and controls cellular processes, including proliferation, differentiation, and apoptosis. It is essential for chondrocyte differentiation, proliferation, apoptosis and normal bone development functions. FGFR-3 alpha (IIIc) Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The FGFR-3 protein is a tyrosine protein kinase that serves as a cell surface receptor for fibroblast growth factors and controls cellular processes, including proliferation, differentiation, and apoptosis. It is essential for chondrocyte differentiation, proliferation, apoptosis and normal bone development functions. FGFR-3 alpha (IIIc) Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.

Background

FGFR-3 protein is a tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and is crucial for regulating cell proliferation, differentiation, and apoptosis. It plays a vital role in chondrocyte differentiation, proliferation, and apoptosis, as well as in normal skeleton development. FGFR-3 also regulates osteogenesis and postnatal bone mineralization in osteoblasts. It can promote apoptosis in chondrocytes but has also been implicated in cancer cell proliferation. Additionally, FGFR-3 is essential for the development of the inner ear and phosphorylates PLCG1, CBL, and FRS2. Ligand binding to FGFR-3 triggers various signaling cascades, including the production of diacylglycerol and inositol 1,4,5-trisphosphate through activation of PLCG1. Phosphorylation of FRS2 leads to the recruitment of GRB2, GAB1, PIK3R1, and SOS1, ultimately activating the RAS, MAPK1/ERK2, MAPK3/ERK1, and AKT1 signaling pathways. FGFR-3 also plays a role in vitamin D metabolism regulation. Aberrant signaling occurs when mutations result in constitutive kinase activation or impair normal FGFR3 maturation, internalization, and degradation. Overexpression or constitutive activation of FGFR-3 promotes the activation of STAT1, STAT5A, and STAT5B. Furthermore, FGFR-3 is involved in postnatal lung development.

Verified Bioactivity

1.This product does not contain protein kinase domain.
2.Immobilized FGF basic at 5 µg/mL (100 µL/well) can bind Biotinylated FGFR-3. The ED50 for this effect is 50.77 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized FGF basic at 5 µg/mL (100 µL/well) can bind Biotinylated FGF R3. The ED50 for this effect is 50.77 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FGFR-3 alpha (IIIc) (E21-Y367)
      Accession # Q7TSI8/NP_032036.2
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    FGFR3; Mutant Fibroblast Growth Factor Receptor 3; Prev. ACH; Fibroblast Growth Factor Receptor 3-S; JTK4; Fibroblast Growth Factor Receptor; CD333; Receptor Protein-Tyrosine Kinase; CEK2; Hydroxyaryl-Protein Kinase; FGFR-3; Tyrosine Kinase JTK4; Fibrobla

  • AA Sequence

    EPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVY

  • Molecular Weight

    Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00