FGFR-3 alpha (IIIc) Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The FGFR-3 protein is a tyrosine protein kinase that serves as a cell surface receptor for fibroblast growth factors and controls cellular processes, including proliferation, differentiation, and apoptosis. It is essential for chondrocyte differentiation, proliferation, apoptosis and normal bone development functions. FGFR-3 alpha (IIIc) Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The FGFR-3 protein is a tyrosine protein kinase that serves as a cell surface receptor for fibroblast growth factors and controls cellular processes, including proliferation, differentiation, and apoptosis. It is essential for chondrocyte differentiation, proliferation, apoptosis and normal bone development functions. FGFR-3 alpha (IIIc) Protein, Mouse (HEK293, His) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293 , with C-His labeled tag.
Background
FGFR-3 protein is a tyrosine-protein kinase that acts as a cell-surface receptor for fibroblast growth factors and is crucial for regulating cell proliferation, differentiation, and apoptosis. It plays a vital role in chondrocyte differentiation, proliferation, and apoptosis, as well as in normal skeleton development. FGFR-3 also regulates osteogenesis and postnatal bone mineralization in osteoblasts. It can promote apoptosis in chondrocytes but has also been implicated in cancer cell proliferation. Additionally, FGFR-3 is essential for the development of the inner ear and phosphorylates PLCG1, CBL, and FRS2. Ligand binding to FGFR-3 triggers various signaling cascades, including the production of diacylglycerol and inositol 1,4,5-trisphosphate through activation of PLCG1. Phosphorylation of FRS2 leads to the recruitment of GRB2, GAB1, PIK3R1, and SOS1, ultimately activating the RAS, MAPK1/ERK2, MAPK3/ERK1, and AKT1 signaling pathways. FGFR-3 also plays a role in vitamin D metabolism regulation. Aberrant signaling occurs when mutations result in constitutive kinase activation or impair normal FGFR3 maturation, internalization, and degradation. Overexpression or constitutive activation of FGFR-3 promotes the activation of STAT1, STAT5A, and STAT5B. Furthermore, FGFR-3 is involved in postnatal lung development.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Immobilized FGF basic at 5 µg/mL (100 µL/well) can bind Biotinylated FGFR-3. The ED50 for this effect is 50.77 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q7TSI8/NP_032036.2 (E21-Y367)
-
Molecular Construction
-
N-term
-
FGFR-3 alpha (IIIc) (E21-Y367)
Accession # Q7TSI8/NP_032036.2 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FGFR3; Mutant Fibroblast Growth Factor Receptor 3; Prev. ACH; Fibroblast Growth Factor Receptor 3-S; JTK4; Fibroblast Growth Factor Receptor; CD333; Receptor Protein-Tyrosine Kinase; CEK2; Hydroxyaryl-Protein Kinase; FGFR-3; Tyrosine Kinase JTK4; Fibrobla
-
AA Sequence
EPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVY
-
Molecular Weight
Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)